EP3294328A1 - Constructs targeting hpv16-e7 peptide/mhc complexes and uses thereof - Google Patents
Constructs targeting hpv16-e7 peptide/mhc complexes and uses thereofInfo
- Publication number
- EP3294328A1 EP3294328A1 EP16793285.4A EP16793285A EP3294328A1 EP 3294328 A1 EP3294328 A1 EP 3294328A1 EP 16793285 A EP16793285 A EP 16793285A EP 3294328 A1 EP3294328 A1 EP 3294328A1
- Authority
- EP
- European Patent Office
- Prior art keywords
- amino acid
- seq
- acid sequence
- e7mc
- variant
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Withdrawn
Links
- 101000767631 Human papillomavirus type 16 Protein E7 Proteins 0.000 title claims abstract description 317
- 230000008685 targeting Effects 0.000 title description 4
- 102000043129 MHC class I family Human genes 0.000 claims abstract description 252
- 108091054437 MHC class I family Proteins 0.000 claims abstract description 252
- 238000000034 method Methods 0.000 claims abstract description 108
- 125000003275 alpha amino acid group Chemical group 0.000 claims description 1501
- 238000006467 substitution reaction Methods 0.000 claims description 477
- 210000004027 cell Anatomy 0.000 claims description 270
- 108090000765 processed proteins & peptides Proteins 0.000 claims description 147
- 239000000427 antigen Substances 0.000 claims description 130
- 108091007433 antigens Proteins 0.000 claims description 129
- 102000036639 antigens Human genes 0.000 claims description 129
- 230000004068 intracellular signaling Effects 0.000 claims description 122
- 239000012636 effector Substances 0.000 claims description 103
- 210000001744 T-lymphocyte Anatomy 0.000 claims description 96
- 108010019670 Chimeric Antigen Receptors Proteins 0.000 claims description 85
- 102000004196 processed proteins & peptides Human genes 0.000 claims description 69
- 150000001413 amino acids Chemical class 0.000 claims description 67
- 206010028980 Neoplasm Diseases 0.000 claims description 64
- 229940127121 immunoconjugate Drugs 0.000 claims description 63
- 108090000623 proteins and genes Proteins 0.000 claims description 62
- 108010075704 HLA-A Antigens Proteins 0.000 claims description 61
- 102210042925 HLA-A*02:01 Human genes 0.000 claims description 55
- 101000914514 Homo sapiens T-cell-specific surface glycoprotein CD28 Proteins 0.000 claims description 55
- 102100027213 T-cell-specific surface glycoprotein CD28 Human genes 0.000 claims description 55
- 229920001184 polypeptide Polymers 0.000 claims description 51
- 201000011510 cancer Diseases 0.000 claims description 50
- 150000007523 nucleic acids Chemical class 0.000 claims description 50
- 102000039446 nucleic acids Human genes 0.000 claims description 42
- 108020004707 nucleic acids Proteins 0.000 claims description 42
- 208000037265 diseases, disorders, signs and symptoms Diseases 0.000 claims description 40
- 239000003814 drug Substances 0.000 claims description 40
- 102000004169 proteins and genes Human genes 0.000 claims description 40
- 201000010099 disease Diseases 0.000 claims description 38
- 229940124597 therapeutic agent Drugs 0.000 claims description 27
- 229940079593 drug Drugs 0.000 claims description 22
- 108010047041 Complementarity Determining Regions Proteins 0.000 claims description 17
- 239000003053 toxin Substances 0.000 claims description 13
- 231100000765 toxin Toxicity 0.000 claims description 13
- 108700012359 toxins Proteins 0.000 claims description 13
- 239000008194 pharmaceutical composition Substances 0.000 claims description 12
- 206010041823 squamous cell carcinoma Diseases 0.000 claims description 8
- 102100030886 Complement receptor type 1 Human genes 0.000 claims description 7
- 101000727061 Homo sapiens Complement receptor type 1 Proteins 0.000 claims description 7
- 101000851370 Homo sapiens Tumor necrosis factor receptor superfamily member 9 Proteins 0.000 claims description 7
- 102100036856 Tumor necrosis factor receptor superfamily member 9 Human genes 0.000 claims description 7
- 210000004899 c-terminal region Anatomy 0.000 claims description 6
- 206010008342 Cervix carcinoma Diseases 0.000 claims description 5
- 102100022153 Tumor necrosis factor receptor superfamily member 4 Human genes 0.000 claims description 5
- 208000006105 Uterine Cervical Neoplasms Diseases 0.000 claims description 5
- 201000010881 cervical cancer Diseases 0.000 claims description 5
- 208000014829 head and neck neoplasm Diseases 0.000 claims description 5
- 102100027207 CD27 antigen Human genes 0.000 claims description 4
- 102100032937 CD40 ligand Human genes 0.000 claims description 4
- 101000914511 Homo sapiens CD27 antigen Proteins 0.000 claims description 4
- 101000801234 Homo sapiens Tumor necrosis factor receptor superfamily member 18 Proteins 0.000 claims description 4
- 102100033728 Tumor necrosis factor receptor superfamily member 18 Human genes 0.000 claims description 4
- 101710165473 Tumor necrosis factor receptor superfamily member 4 Proteins 0.000 claims description 4
- 108010029697 CD40 Ligand Proteins 0.000 claims description 3
- 241000701806 Human papillomavirus Species 0.000 claims description 3
- 108010061593 Member 14 Tumor Necrosis Factor Receptors Proteins 0.000 claims description 3
- 206010031096 Oropharyngeal cancer Diseases 0.000 claims description 3
- 206010057444 Oropharyngeal neoplasm Diseases 0.000 claims description 3
- 102100028785 Tumor necrosis factor receptor superfamily member 14 Human genes 0.000 claims description 3
- 230000009977 dual effect Effects 0.000 claims description 3
- 201000010536 head and neck cancer Diseases 0.000 claims description 3
- 201000006958 oropharynx cancer Diseases 0.000 claims description 3
- 229910052698 phosphorus Inorganic materials 0.000 claims description 3
- 102100028972 HLA class I histocompatibility antigen, A alpha chain Human genes 0.000 claims 4
- 235000001014 amino acid Nutrition 0.000 description 492
- 230000027455 binding Effects 0.000 description 167
- 238000009739 binding Methods 0.000 description 165
- 241000282414 Homo sapiens Species 0.000 description 129
- 102000011786 HLA-A Antigens Human genes 0.000 description 57
- 229940024606 amino acid Drugs 0.000 description 54
- 230000011664 signaling Effects 0.000 description 49
- 230000010056 antibody-dependent cellular cytotoxicity Effects 0.000 description 43
- 235000018102 proteins Nutrition 0.000 description 38
- 108010087819 Fc receptors Proteins 0.000 description 32
- 102000009109 Fc receptors Human genes 0.000 description 32
- 230000006870 function Effects 0.000 description 31
- 239000013598 vector Substances 0.000 description 31
- 239000012634 fragment Substances 0.000 description 29
- 230000014509 gene expression Effects 0.000 description 26
- -1 CD3C Proteins 0.000 description 24
- 108060003951 Immunoglobulin Proteins 0.000 description 24
- VSJKWCGYPAHWDS-FQEVSTJZSA-N camptothecin Chemical compound C1=CC=C2C=C(CN3C4=CC5=C(C3=O)COC(=O)[C@]5(O)CC)C4=NC2=C1 VSJKWCGYPAHWDS-FQEVSTJZSA-N 0.000 description 24
- 102000018358 immunoglobulin Human genes 0.000 description 24
- 230000000694 effects Effects 0.000 description 22
- 230000003834 intracellular effect Effects 0.000 description 20
- 239000000203 mixture Substances 0.000 description 20
- 102000005962 receptors Human genes 0.000 description 18
- 108020003175 receptors Proteins 0.000 description 18
- 208000022361 Human papillomavirus infectious disease Diseases 0.000 description 17
- 238000003556 assay Methods 0.000 description 17
- 230000004540 complement-dependent cytotoxicity Effects 0.000 description 17
- 210000001151 cytotoxic T lymphocyte Anatomy 0.000 description 17
- 238000001727 in vivo Methods 0.000 description 17
- 238000011282 treatment Methods 0.000 description 17
- 108020004414 DNA Proteins 0.000 description 16
- 108700018351 Major Histocompatibility Complex Proteins 0.000 description 16
- 102100026120 IgG receptor FcRn large subunit p51 Human genes 0.000 description 15
- 230000003213 activating effect Effects 0.000 description 15
- 231100000433 cytotoxic Toxicity 0.000 description 15
- 230000001472 cytotoxic effect Effects 0.000 description 15
- 150000002632 lipids Chemical class 0.000 description 15
- 230000020382 suppression by virus of host antigen processing and presentation of peptide antigen via MHC class I Effects 0.000 description 15
- 238000000338 in vitro Methods 0.000 description 14
- 102100035360 Cerebellar degeneration-related antigen 1 Human genes 0.000 description 13
- SHZGCJCMOBCMKK-UHFFFAOYSA-N D-mannomethylose Natural products CC1OC(O)C(O)C(O)C1O SHZGCJCMOBCMKK-UHFFFAOYSA-N 0.000 description 13
- PNNNRSAQSRJVSB-SLPGGIOYSA-N Fucose Natural products C[C@H](O)[C@@H](O)[C@H](O)[C@H](O)C=O PNNNRSAQSRJVSB-SLPGGIOYSA-N 0.000 description 13
- SHZGCJCMOBCMKK-DHVFOXMCSA-N L-fucopyranose Chemical compound C[C@@H]1OC(O)[C@@H](O)[C@H](O)[C@@H]1O SHZGCJCMOBCMKK-DHVFOXMCSA-N 0.000 description 13
- 241000699666 Mus <mouse, genus> Species 0.000 description 13
- 108091028043 Nucleic acid sequence Proteins 0.000 description 13
- 125000000539 amino acid group Chemical group 0.000 description 13
- 108091007491 NSP3 Papain-like protease domains Proteins 0.000 description 12
- 210000004408 hybridoma Anatomy 0.000 description 12
- 230000001976 improved effect Effects 0.000 description 12
- 230000001965 increasing effect Effects 0.000 description 12
- 108091008874 T cell receptors Proteins 0.000 description 11
- 102000016266 T-Cell Antigen Receptors Human genes 0.000 description 11
- 230000004913 activation Effects 0.000 description 11
- 239000011324 bead Substances 0.000 description 11
- 238000001943 fluorescence-activated cell sorting Methods 0.000 description 11
- 210000004698 lymphocyte Anatomy 0.000 description 11
- 230000001404 mediated effect Effects 0.000 description 11
- 210000001616 monocyte Anatomy 0.000 description 11
- 238000002823 phage display Methods 0.000 description 11
- 239000000243 solution Substances 0.000 description 11
- 102000004190 Enzymes Human genes 0.000 description 10
- 108090000790 Enzymes Proteins 0.000 description 10
- 102000008394 Immunoglobulin Fragments Human genes 0.000 description 10
- 108010021625 Immunoglobulin Fragments Proteins 0.000 description 10
- ROHFNLRQFUQHCH-YFKPBYRVSA-N L-leucine Chemical compound CC(C)C[C@H](N)C(O)=O ROHFNLRQFUQHCH-YFKPBYRVSA-N 0.000 description 10
- 239000003795 chemical substances by application Substances 0.000 description 10
- 210000004443 dendritic cell Anatomy 0.000 description 10
- 229940088598 enzyme Drugs 0.000 description 10
- 239000013604 expression vector Substances 0.000 description 10
- 210000002865 immune cell Anatomy 0.000 description 10
- 239000002502 liposome Substances 0.000 description 10
- 230000004936 stimulating effect Effects 0.000 description 10
- 239000000126 substance Substances 0.000 description 10
- 102000017420 CD3 protein, epsilon/gamma/delta subunit Human genes 0.000 description 9
- 108050005493 CD3 protein, epsilon/gamma/delta subunit Proteins 0.000 description 9
- 230000004075 alteration Effects 0.000 description 9
- 239000012830 cancer therapeutic Substances 0.000 description 9
- 230000003247 decreasing effect Effects 0.000 description 9
- 238000004519 manufacturing process Methods 0.000 description 9
- 210000000822 natural killer cell Anatomy 0.000 description 9
- 108091033319 polynucleotide Proteins 0.000 description 9
- 102000040430 polynucleotide Human genes 0.000 description 9
- 239000002157 polynucleotide Substances 0.000 description 9
- COLNVLDHVKWLRT-QMMMGPOBSA-N L-phenylalanine Chemical compound OC(=O)[C@@H](N)CC1=CC=CC=C1 COLNVLDHVKWLRT-QMMMGPOBSA-N 0.000 description 8
- 108700008625 Reporter Genes Proteins 0.000 description 8
- 230000008901 benefit Effects 0.000 description 8
- 230000004927 fusion Effects 0.000 description 8
- 210000002540 macrophage Anatomy 0.000 description 8
- 210000000440 neutrophil Anatomy 0.000 description 8
- 229940002612 prodrug Drugs 0.000 description 8
- 239000000651 prodrug Substances 0.000 description 8
- 230000002285 radioactive effect Effects 0.000 description 8
- IAKHMKGGTNLKSZ-INIZCTEOSA-N (S)-colchicine Chemical compound C1([C@@H](NC(C)=O)CC2)=CC(=O)C(OC)=CC=C1C1=C2C=C(OC)C(OC)=C1OC IAKHMKGGTNLKSZ-INIZCTEOSA-N 0.000 description 7
- 108700028369 Alleles Proteins 0.000 description 7
- 102100034922 T-cell surface glycoprotein CD8 alpha chain Human genes 0.000 description 7
- KZSNJWFQEVHDMF-UHFFFAOYSA-N Valine Natural products CC(C)C(N)C(O)=O KZSNJWFQEVHDMF-UHFFFAOYSA-N 0.000 description 7
- 210000004369 blood Anatomy 0.000 description 7
- 239000008280 blood Substances 0.000 description 7
- 239000000562 conjugate Substances 0.000 description 7
- XUJNEKJLAYXESH-UHFFFAOYSA-N cysteine Natural products SCC(N)C(O)=O XUJNEKJLAYXESH-UHFFFAOYSA-N 0.000 description 7
- 235000018417 cysteine Nutrition 0.000 description 7
- 230000001086 cytosolic effect Effects 0.000 description 7
- 231100000599 cytotoxic agent Toxicity 0.000 description 7
- 238000000684 flow cytometry Methods 0.000 description 7
- 230000004048 modification Effects 0.000 description 7
- 238000012986 modification Methods 0.000 description 7
- 150000002482 oligosaccharides Chemical class 0.000 description 7
- 238000004091 panning Methods 0.000 description 7
- 210000003819 peripheral blood mononuclear cell Anatomy 0.000 description 7
- 238000000159 protein binding assay Methods 0.000 description 7
- NFGXHKASABOEEW-UHFFFAOYSA-N 1-methylethyl 11-methoxy-3,7,11-trimethyl-2,4-dodecadienoate Chemical compound COC(C)(C)CCCC(C)CC=CC(C)=CC(=O)OC(C)C NFGXHKASABOEEW-UHFFFAOYSA-N 0.000 description 6
- 108091026890 Coding region Proteins 0.000 description 6
- AOJJSUZBOXZQNB-TZSSRYMLSA-N Doxorubicin Chemical compound O([C@H]1C[C@@](O)(CC=2C(O)=C3C(=O)C=4C=CC=C(C=4C(=O)C3=C(O)C=21)OC)C(=O)CO)[C@H]1C[C@H](N)[C@H](O)[C@H](C)O1 AOJJSUZBOXZQNB-TZSSRYMLSA-N 0.000 description 6
- OUYCCCASQSFEME-QMMMGPOBSA-N L-tyrosine Chemical compound OC(=O)[C@@H](N)CC1=CC=C(O)C=C1 OUYCCCASQSFEME-QMMMGPOBSA-N 0.000 description 6
- 102100029193 Low affinity immunoglobulin gamma Fc region receptor III-A Human genes 0.000 description 6
- 108020004511 Recombinant DNA Proteins 0.000 description 6
- 125000003295 alanine group Chemical group N[C@@H](C)C(=O)* 0.000 description 6
- 210000004978 chinese hamster ovary cell Anatomy 0.000 description 6
- 230000000875 corresponding effect Effects 0.000 description 6
- 125000000151 cysteine group Chemical group N[C@@H](CS)C(=O)* 0.000 description 6
- 230000007423 decrease Effects 0.000 description 6
- 239000001963 growth medium Substances 0.000 description 6
- 238000003780 insertion Methods 0.000 description 6
- 230000037431 insertion Effects 0.000 description 6
- 230000002147 killing effect Effects 0.000 description 6
- 239000003446 ligand Substances 0.000 description 6
- 229920001542 oligosaccharide Polymers 0.000 description 6
- WYWHKKSPHMUBEB-UHFFFAOYSA-N tioguanine Chemical compound N1C(N)=NC(=S)C2=C1N=CN2 WYWHKKSPHMUBEB-UHFFFAOYSA-N 0.000 description 6
- STQGQHZAVUOBTE-UHFFFAOYSA-N 7-Cyan-hept-2t-en-4,6-diinsaeure Natural products C1=2C(O)=C3C(=O)C=4C(OC)=CC=CC=4C(=O)C3=C(O)C=2CC(O)(C(C)=O)CC1OC1CC(N)C(O)C(C)O1 STQGQHZAVUOBTE-UHFFFAOYSA-N 0.000 description 5
- 102210047469 A*02:01 Human genes 0.000 description 5
- 239000004971 Cross linker Substances 0.000 description 5
- LYCAIKOWRPUZTN-UHFFFAOYSA-N Ethylene glycol Chemical compound OCCO LYCAIKOWRPUZTN-UHFFFAOYSA-N 0.000 description 5
- 102100028971 HLA class I histocompatibility antigen, C alpha chain Human genes 0.000 description 5
- 108010052199 HLA-C Antigens Proteins 0.000 description 5
- 101000917858 Homo sapiens Low affinity immunoglobulin gamma Fc region receptor III-A Proteins 0.000 description 5
- 101000716102 Homo sapiens T-cell surface glycoprotein CD4 Proteins 0.000 description 5
- 241000699670 Mus sp. Species 0.000 description 5
- NWIBSHFKIJFRCO-WUDYKRTCSA-N Mytomycin Chemical compound C1N2C(C(C(C)=C(N)C3=O)=O)=C3[C@@H](COC(N)=O)[C@@]2(OC)[C@@H]2[C@H]1N2 NWIBSHFKIJFRCO-WUDYKRTCSA-N 0.000 description 5
- 206010035226 Plasma cell myeloma Diseases 0.000 description 5
- 239000002202 Polyethylene glycol Substances 0.000 description 5
- 108010039491 Ricin Proteins 0.000 description 5
- 102100036011 T-cell surface glycoprotein CD4 Human genes 0.000 description 5
- 238000013459 approach Methods 0.000 description 5
- 150000001720 carbohydrates Chemical group 0.000 description 5
- 150000001875 compounds Chemical class 0.000 description 5
- 229940127089 cytotoxic agent Drugs 0.000 description 5
- 239000002254 cytotoxic agent Substances 0.000 description 5
- 230000002950 deficient Effects 0.000 description 5
- 238000012217 deletion Methods 0.000 description 5
- 230000037430 deletion Effects 0.000 description 5
- 238000005516 engineering process Methods 0.000 description 5
- 230000012010 growth Effects 0.000 description 5
- 210000000987 immune system Anatomy 0.000 description 5
- 238000011534 incubation Methods 0.000 description 5
- 239000003112 inhibitor Substances 0.000 description 5
- 230000002401 inhibitory effect Effects 0.000 description 5
- 230000003993 interaction Effects 0.000 description 5
- 125000001360 methionine group Chemical group N[C@@H](CCSC)C(=O)* 0.000 description 5
- 201000000050 myeloid neoplasm Diseases 0.000 description 5
- 239000002773 nucleotide Substances 0.000 description 5
- 125000003729 nucleotide group Chemical group 0.000 description 5
- 238000010647 peptide synthesis reaction Methods 0.000 description 5
- 229920001223 polyethylene glycol Polymers 0.000 description 5
- 238000003752 polymerase chain reaction Methods 0.000 description 5
- 230000008569 process Effects 0.000 description 5
- 230000001105 regulatory effect Effects 0.000 description 5
- 239000007787 solid Substances 0.000 description 5
- 239000013603 viral vector Substances 0.000 description 5
- TVZGACDUOSZQKY-LBPRGKRZSA-N 4-aminofolic acid Chemical class C1=NC2=NC(N)=NC(N)=C2N=C1CNC1=CC=C(C(=O)N[C@@H](CCC(O)=O)C(O)=O)C=C1 TVZGACDUOSZQKY-LBPRGKRZSA-N 0.000 description 4
- 108091007741 Chimeric antigen receptor T cells Proteins 0.000 description 4
- BWGNESOTFCXPMA-UHFFFAOYSA-N Dihydrogen disulfide Chemical compound SS BWGNESOTFCXPMA-UHFFFAOYSA-N 0.000 description 4
- 102100028976 HLA class I histocompatibility antigen, B alpha chain Human genes 0.000 description 4
- 108010058607 HLA-B Antigens Proteins 0.000 description 4
- 102000008949 Histocompatibility Antigens Class I Human genes 0.000 description 4
- 108010088652 Histocompatibility Antigens Class I Proteins 0.000 description 4
- 108010091358 Hypoxanthine Phosphoribosyltransferase Proteins 0.000 description 4
- 108010067060 Immunoglobulin Variable Region Proteins 0.000 description 4
- 102000017727 Immunoglobulin Variable Region Human genes 0.000 description 4
- FBOZXECLQNJBKD-ZDUSSCGKSA-N L-methotrexate Chemical compound C=1N=C2N=C(N)N=C(N)C2=NC=1CN(C)C1=CC=C(C(=O)N[C@@H](CCC(O)=O)C(O)=O)C=C1 FBOZXECLQNJBKD-ZDUSSCGKSA-N 0.000 description 4
- LRQKBLKVPFOOQJ-YFKPBYRVSA-N L-norleucine Chemical compound CCCC[C@H]([NH3+])C([O-])=O LRQKBLKVPFOOQJ-YFKPBYRVSA-N 0.000 description 4
- 241000713666 Lentivirus Species 0.000 description 4
- KDXKERNSBIXSRK-UHFFFAOYSA-N Lysine Natural products NCCCCC(N)C(O)=O KDXKERNSBIXSRK-UHFFFAOYSA-N 0.000 description 4
- 241001465754 Metazoa Species 0.000 description 4
- OVRNDRQMDRJTHS-UHFFFAOYSA-N N-acelyl-D-glucosamine Natural products CC(=O)NC1C(O)OC(CO)C(O)C1O OVRNDRQMDRJTHS-UHFFFAOYSA-N 0.000 description 4
- MBLBDJOUHNCFQT-LXGUWJNJSA-N N-acetylglucosamine Natural products CC(=O)N[C@@H](C=O)[C@@H](O)[C@H](O)[C@H](O)CO MBLBDJOUHNCFQT-LXGUWJNJSA-N 0.000 description 4
- 206010057249 Phagocytosis Diseases 0.000 description 4
- 241000283984 Rodentia Species 0.000 description 4
- 241000700605 Viruses Species 0.000 description 4
- VWQVUPCCIRVNHF-OUBTZVSYSA-N Yttrium-90 Chemical compound [90Y] VWQVUPCCIRVNHF-OUBTZVSYSA-N 0.000 description 4
- 235000004279 alanine Nutrition 0.000 description 4
- 229940049595 antibody-drug conjugate Drugs 0.000 description 4
- 238000002617 apheresis Methods 0.000 description 4
- 230000004071 biological effect Effects 0.000 description 4
- 238000004132 cross linking Methods 0.000 description 4
- 230000009089 cytolysis Effects 0.000 description 4
- 239000000824 cytostatic agent Substances 0.000 description 4
- 230000001085 cytostatic effect Effects 0.000 description 4
- 238000002784 cytotoxicity assay Methods 0.000 description 4
- 231100000263 cytotoxicity test Toxicity 0.000 description 4
- 239000002619 cytotoxin Substances 0.000 description 4
- STQGQHZAVUOBTE-VGBVRHCVSA-N daunorubicin Chemical compound O([C@H]1C[C@@](O)(CC=2C(O)=C3C(=O)C=4C=CC=C(C=4C(=O)C3=C(O)C=21)OC)C(C)=O)[C@H]1C[C@H](N)[C@H](O)[C@H](C)O1 STQGQHZAVUOBTE-VGBVRHCVSA-N 0.000 description 4
- 230000001419 dependent effect Effects 0.000 description 4
- 230000003292 diminished effect Effects 0.000 description 4
- 210000003162 effector t lymphocyte Anatomy 0.000 description 4
- 238000009472 formulation Methods 0.000 description 4
- 230000013595 glycosylation Effects 0.000 description 4
- 238000006206 glycosylation reaction Methods 0.000 description 4
- 229940072221 immunoglobulins Drugs 0.000 description 4
- 230000000977 initiatory effect Effects 0.000 description 4
- 210000004962 mammalian cell Anatomy 0.000 description 4
- 125000002496 methyl group Chemical group [H]C([H])([H])* 0.000 description 4
- 239000000693 micelle Substances 0.000 description 4
- 230000008782 phagocytosis Effects 0.000 description 4
- 229920000642 polymer Polymers 0.000 description 4
- 238000002360 preparation method Methods 0.000 description 4
- 238000000746 purification Methods 0.000 description 4
- 230000002829 reductive effect Effects 0.000 description 4
- 238000011160 research Methods 0.000 description 4
- 239000000523 sample Substances 0.000 description 4
- 150000003384 small molecules Chemical class 0.000 description 4
- 125000006850 spacer group Chemical group 0.000 description 4
- 230000004083 survival effect Effects 0.000 description 4
- 230000001225 therapeutic effect Effects 0.000 description 4
- 210000001519 tissue Anatomy 0.000 description 4
- 238000012546 transfer Methods 0.000 description 4
- 210000004881 tumor cell Anatomy 0.000 description 4
- 241000701161 unidentified adenovirus Species 0.000 description 4
- 108091032973 (ribonucleotides)n+m Proteins 0.000 description 3
- 102000002260 Alkaline Phosphatase Human genes 0.000 description 3
- 108020004774 Alkaline Phosphatase Proteins 0.000 description 3
- 206010061424 Anal cancer Diseases 0.000 description 3
- 208000007860 Anus Neoplasms Diseases 0.000 description 3
- 206010003445 Ascites Diseases 0.000 description 3
- 102000014914 Carrier Proteins Human genes 0.000 description 3
- 101710112752 Cytotoxin Proteins 0.000 description 3
- 108010053187 Diphtheria Toxin Proteins 0.000 description 3
- 102000016607 Diphtheria Toxin Human genes 0.000 description 3
- GHASVSINZRGABV-UHFFFAOYSA-N Fluorouracil Chemical compound FC1=CNC(=O)NC1=O GHASVSINZRGABV-UHFFFAOYSA-N 0.000 description 3
- PEDCQBHIVMGVHV-UHFFFAOYSA-N Glycerine Chemical compound OCC(O)CO PEDCQBHIVMGVHV-UHFFFAOYSA-N 0.000 description 3
- 102100028966 HLA class I histocompatibility antigen, alpha chain F Human genes 0.000 description 3
- 102100028967 HLA class I histocompatibility antigen, alpha chain G Human genes 0.000 description 3
- 108010024164 HLA-G Antigens Proteins 0.000 description 3
- 241000282412 Homo Species 0.000 description 3
- 101000986080 Homo sapiens HLA class I histocompatibility antigen, alpha chain F Proteins 0.000 description 3
- 101000934372 Homo sapiens Macrosialin Proteins 0.000 description 3
- 101000581981 Homo sapiens Neural cell adhesion molecule 1 Proteins 0.000 description 3
- 102100029098 Hypoxanthine-guanine phosphoribosyltransferase Human genes 0.000 description 3
- 102000018071 Immunoglobulin Fc Fragments Human genes 0.000 description 3
- 108010091135 Immunoglobulin Fc Fragments Proteins 0.000 description 3
- 102000006496 Immunoglobulin Heavy Chains Human genes 0.000 description 3
- 108010019476 Immunoglobulin Heavy Chains Proteins 0.000 description 3
- 102000013463 Immunoglobulin Light Chains Human genes 0.000 description 3
- 108010065825 Immunoglobulin Light Chains Proteins 0.000 description 3
- 102100025136 Macrosialin Human genes 0.000 description 3
- 206010027476 Metastases Diseases 0.000 description 3
- 241001529936 Murinae Species 0.000 description 3
- OVRNDRQMDRJTHS-RTRLPJTCSA-N N-acetyl-D-glucosamine Chemical compound CC(=O)N[C@H]1C(O)O[C@H](CO)[C@@H](O)[C@@H]1O OVRNDRQMDRJTHS-RTRLPJTCSA-N 0.000 description 3
- 102100027347 Neural cell adhesion molecule 1 Human genes 0.000 description 3
- DNIAPMSPPWPWGF-UHFFFAOYSA-N Propylene glycol Chemical compound CC(O)CO DNIAPMSPPWPWGF-UHFFFAOYSA-N 0.000 description 3
- 208000000102 Squamous Cell Carcinoma of Head and Neck Diseases 0.000 description 3
- 230000006044 T cell activation Effects 0.000 description 3
- 101710183280 Topoisomerase Proteins 0.000 description 3
- JXLYSJRDGCGARV-WWYNWVTFSA-N Vinblastine Natural products O=C(O[C@H]1[C@](O)(C(=O)OC)[C@@H]2N(C)c3c(cc(c(OC)c3)[C@]3(C(=O)OC)c4[nH]c5c(c4CCN4C[C@](O)(CC)C[C@H](C3)C4)cccc5)[C@@]32[C@H]2[C@@]1(CC)C=CCN2CC3)C JXLYSJRDGCGARV-WWYNWVTFSA-N 0.000 description 3
- 230000009824 affinity maturation Effects 0.000 description 3
- 230000001270 agonistic effect Effects 0.000 description 3
- 238000004458 analytical method Methods 0.000 description 3
- 238000010171 animal model Methods 0.000 description 3
- 239000002246 antineoplastic agent Substances 0.000 description 3
- 201000011165 anus cancer Diseases 0.000 description 3
- 210000003719 b-lymphocyte Anatomy 0.000 description 3
- 108091008324 binding proteins Proteins 0.000 description 3
- 230000015572 biosynthetic process Effects 0.000 description 3
- 239000000872 buffer Substances 0.000 description 3
- HXCHCVDVKSCDHU-LULTVBGHSA-N calicheamicin Chemical compound C1[C@H](OC)[C@@H](NCC)CO[C@H]1O[C@H]1[C@H](O[C@@H]2C\3=C(NC(=O)OC)C(=O)C[C@](C/3=C/CSSSC)(O)C#C\C=C/C#C2)O[C@H](C)[C@@H](NO[C@@H]2O[C@H](C)[C@@H](SC(=O)C=3C(=C(OC)C(O[C@H]4[C@@H]([C@H](OC)[C@@H](O)[C@H](C)O4)O)=C(I)C=3C)OC)[C@@H](O)C2)[C@@H]1O HXCHCVDVKSCDHU-LULTVBGHSA-N 0.000 description 3
- 229930195731 calicheamicin Natural products 0.000 description 3
- 235000014633 carbohydrates Nutrition 0.000 description 3
- 230000010261 cell growth Effects 0.000 description 3
- 230000024203 complement activation Effects 0.000 description 3
- 230000000295 complement effect Effects 0.000 description 3
- 230000004154 complement system Effects 0.000 description 3
- 229920001577 copolymer Polymers 0.000 description 3
- 230000000139 costimulatory effect Effects 0.000 description 3
- LOKCTEFSRHRXRJ-UHFFFAOYSA-I dipotassium trisodium dihydrogen phosphate hydrogen phosphate dichloride Chemical compound P(=O)(O)(O)[O-].[K+].P(=O)(O)([O-])[O-].[Na+].[Na+].[Cl-].[K+].[Cl-].[Na+] LOKCTEFSRHRXRJ-UHFFFAOYSA-I 0.000 description 3
- 229960004679 doxorubicin Drugs 0.000 description 3
- 239000003937 drug carrier Substances 0.000 description 3
- 230000033581 fucosylation Effects 0.000 description 3
- 108020001507 fusion proteins Proteins 0.000 description 3
- 102000037865 fusion proteins Human genes 0.000 description 3
- 238000001476 gene delivery Methods 0.000 description 3
- 210000004602 germ cell Anatomy 0.000 description 3
- 230000003053 immunization Effects 0.000 description 3
- 238000002649 immunization Methods 0.000 description 3
- 229940124452 immunizing agent Drugs 0.000 description 3
- 230000016784 immunoglobulin production Effects 0.000 description 3
- 230000001939 inductive effect Effects 0.000 description 3
- 230000005764 inhibitory process Effects 0.000 description 3
- 238000005304 joining Methods 0.000 description 3
- 230000003902 lesion Effects 0.000 description 3
- 210000000265 leukocyte Anatomy 0.000 description 3
- 230000007774 longterm Effects 0.000 description 3
- WKPWGQKGSOKKOO-RSFHAFMBSA-N maytansine Chemical compound CO[C@@H]([C@@]1(O)C[C@](OC(=O)N1)([C@H]([C@@H]1O[C@@]1(C)[C@@H](OC(=O)[C@H](C)N(C)C(C)=O)CC(=O)N1C)C)[H])\C=C\C=C(C)\CC2=CC(OC)=C(Cl)C1=C2 WKPWGQKGSOKKOO-RSFHAFMBSA-N 0.000 description 3
- 239000002609 medium Substances 0.000 description 3
- 230000009401 metastasis Effects 0.000 description 3
- MYWUZJCMWCOHBA-VIFPVBQESA-N methamphetamine Chemical compound CN[C@@H](C)CC1=CC=CC=C1 MYWUZJCMWCOHBA-VIFPVBQESA-N 0.000 description 3
- 230000035772 mutation Effects 0.000 description 3
- 239000013642 negative control Substances 0.000 description 3
- 239000002245 particle Substances 0.000 description 3
- 230000037361 pathway Effects 0.000 description 3
- 239000000546 pharmaceutical excipient Substances 0.000 description 3
- 239000012071 phase Substances 0.000 description 3
- 239000002953 phosphate buffered saline Substances 0.000 description 3
- 229920000915 polyvinyl chloride Polymers 0.000 description 3
- 238000003127 radioimmunoassay Methods 0.000 description 3
- 230000010076 replication Effects 0.000 description 3
- 230000001177 retroviral effect Effects 0.000 description 3
- 238000012552 review Methods 0.000 description 3
- OWPCHSCAPHNHAV-QIPOKPRISA-N rhizoxin Chemical compound C/C([C@@H]([C@@H](C)[C@H]1OC(=O)[C@@H]2O[C@H]2C[C@@H]2C[C@@H](OC(=O)C2)[C@H](C)/C=C/[C@H]2O[C@]2(C)[C@@H](O)C1)OC)=C\C=C\C(\C)=C\C1=COC(C)=N1 OWPCHSCAPHNHAV-QIPOKPRISA-N 0.000 description 3
- 210000002966 serum Anatomy 0.000 description 3
- 241000894007 species Species 0.000 description 3
- JJAHTWIKCUJRDK-UHFFFAOYSA-N succinimidyl 4-(N-maleimidomethyl)cyclohexane-1-carboxylate Chemical compound C1CC(CN2C(C=CC2=O)=O)CCC1C(=O)ON1C(=O)CCC1=O JJAHTWIKCUJRDK-UHFFFAOYSA-N 0.000 description 3
- 238000003786 synthesis reaction Methods 0.000 description 3
- RCINICONZNJXQF-MZXODVADSA-N taxol Chemical compound O([C@@H]1[C@@]2(C[C@@H](C(C)=C(C2(C)C)[C@H](C([C@]2(C)[C@@H](O)C[C@H]3OC[C@]3([C@H]21)OC(C)=O)=O)OC(=O)C)OC(=O)[C@H](O)[C@@H](NC(=O)C=1C=CC=CC=1)C=1C=CC=CC=1)O)C(=O)C1=CC=CC=C1 RCINICONZNJXQF-MZXODVADSA-N 0.000 description 3
- 238000002560 therapeutic procedure Methods 0.000 description 3
- 238000013518 transcription Methods 0.000 description 3
- 230000035897 transcription Effects 0.000 description 3
- OUYCCCASQSFEME-UHFFFAOYSA-N tyrosine Natural products OC(=O)C(N)CC1=CC=C(O)C=C1 OUYCCCASQSFEME-UHFFFAOYSA-N 0.000 description 3
- 241001430294 unidentified retrovirus Species 0.000 description 3
- JWDFQMWEFLOOED-UHFFFAOYSA-N (2,5-dioxopyrrolidin-1-yl) 3-(pyridin-2-yldisulfanyl)propanoate Chemical compound O=C1CCC(=O)N1OC(=O)CCSSC1=CC=CC=N1 JWDFQMWEFLOOED-UHFFFAOYSA-N 0.000 description 2
- DLMYFMLKORXJPO-FQEVSTJZSA-N (2R)-2-amino-3-[(triphenylmethyl)thio]propanoic acid Chemical compound C=1C=CC=CC=1C(C=1C=CC=CC=1)(SC[C@H](N)C(O)=O)C1=CC=CC=C1 DLMYFMLKORXJPO-FQEVSTJZSA-N 0.000 description 2
- ZZKNRXZVGOYGJT-VKHMYHEASA-N (2s)-2-[(2-phosphonoacetyl)amino]butanedioic acid Chemical compound OC(=O)C[C@@H](C(O)=O)NC(=O)CP(O)(O)=O ZZKNRXZVGOYGJT-VKHMYHEASA-N 0.000 description 2
- INAUWOVKEZHHDM-PEDBPRJASA-N (7s,9s)-6,9,11-trihydroxy-9-(2-hydroxyacetyl)-7-[(2r,4s,5s,6s)-5-hydroxy-6-methyl-4-morpholin-4-yloxan-2-yl]oxy-4-methoxy-8,10-dihydro-7h-tetracene-5,12-dione;hydrochloride Chemical compound Cl.N1([C@H]2C[C@@H](O[C@@H](C)[C@H]2O)O[C@H]2C[C@@](O)(CC=3C(O)=C4C(=O)C=5C=CC=C(C=5C(=O)C4=C(O)C=32)OC)C(=O)CO)CCOCC1 INAUWOVKEZHHDM-PEDBPRJASA-N 0.000 description 2
- ZGNLFUXWZJGETL-YUSKDDKASA-N (Z)-[(2S)-2-amino-2-carboxyethyl]-hydroxyimino-oxidoazanium Chemical compound N[C@@H](C\[N+]([O-])=N\O)C(O)=O ZGNLFUXWZJGETL-YUSKDDKASA-N 0.000 description 2
- RYIRMSRYCSMGJA-UHFFFAOYSA-N 1,5,2,4-dioxadithiepane 2,2,4,4-tetraoxide Chemical compound O=S1(=O)CS(=O)(=O)OCCO1 RYIRMSRYCSMGJA-UHFFFAOYSA-N 0.000 description 2
- OUPZKGBUJRBPGC-HLTSFMKQSA-N 1,5-bis[[(2r)-oxiran-2-yl]methyl]-3-[[(2s)-oxiran-2-yl]methyl]-1,3,5-triazinane-2,4,6-trione Chemical compound O=C1N(C[C@H]2OC2)C(=O)N(C[C@H]2OC2)C(=O)N1C[C@H]1CO1 OUPZKGBUJRBPGC-HLTSFMKQSA-N 0.000 description 2
- KHWIRCOLWPNBJP-UHFFFAOYSA-N 1-(2-chloroethyl)-3-(2,6-dioxopiperidin-3-yl)-1-nitrosourea Chemical compound ClCCN(N=O)C(=O)NC1CCC(=O)NC1=O KHWIRCOLWPNBJP-UHFFFAOYSA-N 0.000 description 2
- AWVHFDOHKFRHKQ-UHFFFAOYSA-N 2-[10-(3-aminopropylimino)-6,8-dihydroxy-3-oxo-14,15-diazatetracyclo[7.6.1.02,7.013,16]hexadeca-1,4,6,8,11,13(16)-hexaen-14-yl]ethyl-(2-hydroxyethyl)azanium chloride Chemical compound C1=CC(=NCCCN)C2=C(C3=C(C=CC(=O)C3=C4C2=C1N(N4)CC[NH2+]CCO)O)O.[Cl-] AWVHFDOHKFRHKQ-UHFFFAOYSA-N 0.000 description 2
- SEHSPJCWCBQHPF-UHFFFAOYSA-N 2-chloroethyl methylsulfonylmethanesulfonate Chemical compound CS(=O)(=O)CS(=O)(=O)OCCCl SEHSPJCWCBQHPF-UHFFFAOYSA-N 0.000 description 2
- HDBQZGJWHMCXIL-UHFFFAOYSA-N 3,7-dihydropurine-2-thione Chemical compound SC1=NC=C2NC=NC2=N1 HDBQZGJWHMCXIL-UHFFFAOYSA-N 0.000 description 2
- VPFUWHKTPYPNGT-UHFFFAOYSA-N 3-(3,4-dihydroxyphenyl)-1-(5-hydroxy-2,2-dimethylchromen-6-yl)propan-1-one Chemical compound OC1=C2C=CC(C)(C)OC2=CC=C1C(=O)CCC1=CC=C(O)C(O)=C1 VPFUWHKTPYPNGT-UHFFFAOYSA-N 0.000 description 2
- QNKJFXARIMSDBR-UHFFFAOYSA-N 3-[2-[bis(2-chloroethyl)amino]ethyl]-1,3-diazaspiro[4.5]decane-2,4-dione Chemical compound O=C1N(CCN(CCCl)CCCl)C(=O)NC11CCCCC1 QNKJFXARIMSDBR-UHFFFAOYSA-N 0.000 description 2
- ODACNRQBNVVGAI-UHFFFAOYSA-N 5-[2-chloroethyl(2-fluoroethyl)amino]-6-methyl-1h-pyrimidine-2,4-dione Chemical compound CC=1NC(=O)NC(=O)C=1N(CCF)CCCl ODACNRQBNVVGAI-UHFFFAOYSA-N 0.000 description 2
- IDPUKCWIGUEADI-UHFFFAOYSA-N 5-[bis(2-chloroethyl)amino]uracil Chemical compound ClCCN(CCCl)C1=CNC(=O)NC1=O IDPUKCWIGUEADI-UHFFFAOYSA-N 0.000 description 2
- UPALIKSFLSVKIS-UHFFFAOYSA-N 5-amino-2-[2-(dimethylamino)ethyl]benzo[de]isoquinoline-1,3-dione Chemical compound NC1=CC(C(N(CCN(C)C)C2=O)=O)=C3C2=CC=CC3=C1 UPALIKSFLSVKIS-UHFFFAOYSA-N 0.000 description 2
- XAUDJQYHKZQPEU-KVQBGUIXSA-N 5-aza-2'-deoxycytidine Chemical compound O=C1N=C(N)N=CN1[C@@H]1O[C@H](CO)[C@@H](O)C1 XAUDJQYHKZQPEU-KVQBGUIXSA-N 0.000 description 2
- NMUSYJAQQFHJEW-KVTDHHQDSA-N 5-azacytidine Chemical compound O=C1N=C(N)N=CN1[C@H]1[C@H](O)[C@H](O)[C@@H](CO)O1 NMUSYJAQQFHJEW-KVTDHHQDSA-N 0.000 description 2
- GOJJWDOZNKBUSR-UHFFFAOYSA-N 7-sulfamoyloxyheptyl sulfamate Chemical compound NS(=O)(=O)OCCCCCCCOS(N)(=O)=O GOJJWDOZNKBUSR-UHFFFAOYSA-N 0.000 description 2
- FUXVKZWTXQUGMW-FQEVSTJZSA-N 9-Aminocamptothecin Chemical compound C1=CC(N)=C2C=C(CN3C4=CC5=C(C3=O)COC(=O)[C@]5(O)CC)C4=NC2=C1 FUXVKZWTXQUGMW-FQEVSTJZSA-N 0.000 description 2
- 108010011122 A Kinase Anchor Proteins Proteins 0.000 description 2
- 101000669426 Aspergillus restrictus Ribonuclease mitogillin Proteins 0.000 description 2
- 102100038080 B-cell receptor CD22 Human genes 0.000 description 2
- 102100026189 Beta-galactosidase Human genes 0.000 description 2
- 108010006654 Bleomycin Proteins 0.000 description 2
- COVZYZSDYWQREU-UHFFFAOYSA-N Busulfan Chemical compound CS(=O)(=O)OCCCCOS(C)(=O)=O COVZYZSDYWQREU-UHFFFAOYSA-N 0.000 description 2
- KLWPJMFMVPTNCC-UHFFFAOYSA-N Camptothecin Natural products CCC1(O)C(=O)OCC2=C1C=C3C4Nc5ccccc5C=C4CN3C2=O KLWPJMFMVPTNCC-UHFFFAOYSA-N 0.000 description 2
- DLGOEMSEDOSKAD-UHFFFAOYSA-N Carmustine Chemical compound ClCCNC(=O)N(N=O)CCCl DLGOEMSEDOSKAD-UHFFFAOYSA-N 0.000 description 2
- 108010084457 Cathepsins Proteins 0.000 description 2
- 102000005600 Cathepsins Human genes 0.000 description 2
- 102100021906 Cyclin-O Human genes 0.000 description 2
- 241000701022 Cytomegalovirus Species 0.000 description 2
- WQZGKKKJIJFFOK-QTVWNMPRSA-N D-mannopyranose Chemical compound OC[C@H]1OC(O)[C@@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-QTVWNMPRSA-N 0.000 description 2
- WEAHRLBPCANXCN-UHFFFAOYSA-N Daunomycin Natural products CCC1(O)CC(OC2CC(N)C(O)C(C)O2)c3cc4C(=O)c5c(OC)cccc5C(=O)c4c(O)c3C1 WEAHRLBPCANXCN-UHFFFAOYSA-N 0.000 description 2
- 108010053770 Deoxyribonucleases Proteins 0.000 description 2
- 102000016911 Deoxyribonucleases Human genes 0.000 description 2
- 241000702421 Dependoparvovirus Species 0.000 description 2
- 229920002307 Dextran Polymers 0.000 description 2
- PXGOKWXKJXAPGV-UHFFFAOYSA-N Fluorine Chemical compound FF PXGOKWXKJXAPGV-UHFFFAOYSA-N 0.000 description 2
- 108700004714 Gelonium multiflorum GEL Proteins 0.000 description 2
- WHUUTDBJXJRKMK-UHFFFAOYSA-N Glutamic acid Natural products OC(=O)C(N)CCC(O)=O WHUUTDBJXJRKMK-UHFFFAOYSA-N 0.000 description 2
- SXRSQZLOMIGNAQ-UHFFFAOYSA-N Glutaraldehyde Chemical compound O=CCCCC=O SXRSQZLOMIGNAQ-UHFFFAOYSA-N 0.000 description 2
- 102100028970 HLA class I histocompatibility antigen, alpha chain E Human genes 0.000 description 2
- 101000884305 Homo sapiens B-cell receptor CD22 Proteins 0.000 description 2
- 101000897441 Homo sapiens Cyclin-O Proteins 0.000 description 2
- 101000986085 Homo sapiens HLA class I histocompatibility antigen, alpha chain E Proteins 0.000 description 2
- 101000917839 Homo sapiens Low affinity immunoglobulin gamma Fc region receptor III-B Proteins 0.000 description 2
- 241000725303 Human immunodeficiency virus Species 0.000 description 2
- 241000341655 Human papillomavirus type 16 Species 0.000 description 2
- VSNHCAURESNICA-UHFFFAOYSA-N Hydroxyurea Chemical compound NC(=O)NO VSNHCAURESNICA-UHFFFAOYSA-N 0.000 description 2
- 102000009786 Immunoglobulin Constant Regions Human genes 0.000 description 2
- 108010009817 Immunoglobulin Constant Regions Proteins 0.000 description 2
- 108010054477 Immunoglobulin Fab Fragments Proteins 0.000 description 2
- 102000001706 Immunoglobulin Fab Fragments Human genes 0.000 description 2
- 108700005091 Immunoglobulin Genes Proteins 0.000 description 2
- ZCYVEMRRCGMTRW-AHCXROLUSA-N Iodine-123 Chemical compound [123I] ZCYVEMRRCGMTRW-AHCXROLUSA-N 0.000 description 2
- XEEYBQQBJWHFJM-UHFFFAOYSA-N Iron Chemical compound [Fe] XEEYBQQBJWHFJM-UHFFFAOYSA-N 0.000 description 2
- QNAYBMKLOCPYGJ-REOHCLBHSA-N L-alanine Chemical compound C[C@H](N)C(O)=O QNAYBMKLOCPYGJ-REOHCLBHSA-N 0.000 description 2
- DCXYFEDJOCDNAF-REOHCLBHSA-N L-asparagine Chemical compound OC(=O)[C@@H](N)CC(N)=O DCXYFEDJOCDNAF-REOHCLBHSA-N 0.000 description 2
- CKLJMWTZIZZHCS-REOHCLBHSA-N L-aspartic acid Chemical compound OC(=O)[C@@H](N)CC(O)=O CKLJMWTZIZZHCS-REOHCLBHSA-N 0.000 description 2
- WHUUTDBJXJRKMK-VKHMYHEASA-N L-glutamic acid Chemical compound OC(=O)[C@@H](N)CCC(O)=O WHUUTDBJXJRKMK-VKHMYHEASA-N 0.000 description 2
- KZSNJWFQEVHDMF-BYPYZUCNSA-N L-valine Chemical compound CC(C)[C@H](N)C(O)=O KZSNJWFQEVHDMF-BYPYZUCNSA-N 0.000 description 2
- ROHFNLRQFUQHCH-UHFFFAOYSA-N Leucine Natural products CC(C)CC(N)C(O)=O ROHFNLRQFUQHCH-UHFFFAOYSA-N 0.000 description 2
- GQYIWUVLTXOXAJ-UHFFFAOYSA-N Lomustine Chemical compound ClCCN(N=O)C(=O)NC1CCCCC1 GQYIWUVLTXOXAJ-UHFFFAOYSA-N 0.000 description 2
- 108010064548 Lymphocyte Function-Associated Antigen-1 Proteins 0.000 description 2
- 241000829100 Macaca mulatta polyomavirus 1 Species 0.000 description 2
- 208000032271 Malignant tumor of penis Diseases 0.000 description 2
- 229930126263 Maytansine Natural products 0.000 description 2
- 108010052285 Membrane Proteins Proteins 0.000 description 2
- 241000713333 Mouse mammary tumor virus Species 0.000 description 2
- 238000005481 NMR spectroscopy Methods 0.000 description 2
- 108010038807 Oligopeptides Proteins 0.000 description 2
- 102000015636 Oligopeptides Human genes 0.000 description 2
- 241000283973 Oryctolagus cuniculus Species 0.000 description 2
- 229930012538 Paclitaxel Natural products 0.000 description 2
- 208000002471 Penile Neoplasms Diseases 0.000 description 2
- 206010034299 Penile cancer Diseases 0.000 description 2
- 108091005804 Peptidases Proteins 0.000 description 2
- 208000037581 Persistent Infection Diseases 0.000 description 2
- GLUUGHFHXGJENI-UHFFFAOYSA-N Piperazine Chemical compound C1CNCCN1 GLUUGHFHXGJENI-UHFFFAOYSA-N 0.000 description 2
- 239000004372 Polyvinyl alcohol Substances 0.000 description 2
- RJKFOVLPORLFTN-LEKSSAKUSA-N Progesterone Chemical compound C1CC2=CC(=O)CC[C@]2(C)[C@@H]2[C@@H]1[C@@H]1CC[C@H](C(=O)C)[C@@]1(C)CC2 RJKFOVLPORLFTN-LEKSSAKUSA-N 0.000 description 2
- NBBJYMSMWIIQGU-UHFFFAOYSA-N Propionic aldehyde Chemical compound CCC=O NBBJYMSMWIIQGU-UHFFFAOYSA-N 0.000 description 2
- 239000004365 Protease Substances 0.000 description 2
- 102000004245 Proteasome Endopeptidase Complex Human genes 0.000 description 2
- 108090000708 Proteasome Endopeptidase Complex Proteins 0.000 description 2
- 238000003559 RNA-seq method Methods 0.000 description 2
- 241000700159 Rattus Species 0.000 description 2
- OWPCHSCAPHNHAV-UHFFFAOYSA-N Rhizoxin Natural products C1C(O)C2(C)OC2C=CC(C)C(OC(=O)C2)CC2CC2OC2C(=O)OC1C(C)C(OC)C(C)=CC=CC(C)=CC1=COC(C)=N1 OWPCHSCAPHNHAV-UHFFFAOYSA-N 0.000 description 2
- 108090000829 Ribosome Inactivating Proteins Proteins 0.000 description 2
- 108010090804 Streptavidin Proteins 0.000 description 2
- FOCVUCIESVLUNU-UHFFFAOYSA-N Thiotepa Chemical compound C1CN1P(N1CC1)(=S)N1CC1 FOCVUCIESVLUNU-UHFFFAOYSA-N 0.000 description 2
- IQFYYKKMVGJFEH-XLPZGREQSA-N Thymidine Chemical compound O=C1NC(=O)C(C)=CN1[C@@H]1O[C@H](CO)[C@@H](O)C1 IQFYYKKMVGJFEH-XLPZGREQSA-N 0.000 description 2
- 108090000704 Tubulin Proteins 0.000 description 2
- 102000004243 Tubulin Human genes 0.000 description 2
- 206010047741 Vulval cancer Diseases 0.000 description 2
- 208000004354 Vulvar Neoplasms Diseases 0.000 description 2
- ISFBDLBZPVCEKD-WMZJFQQLSA-N [(Z)-(3-hydroxypyridin-2-yl)methylideneamino]thiourea Chemical compound NC(=S)N\N=C/c1ncccc1O ISFBDLBZPVCEKD-WMZJFQQLSA-N 0.000 description 2
- QAWIHIJWNYOLBE-OKKQSCSOSA-N acivicin Chemical compound OC(=O)[C@@H](N)[C@@H]1CC(Cl)=NO1 QAWIHIJWNYOLBE-OKKQSCSOSA-N 0.000 description 2
- 238000001042 affinity chromatography Methods 0.000 description 2
- 238000012867 alanine scanning Methods 0.000 description 2
- 150000001299 aldehydes Chemical class 0.000 description 2
- WQZGKKKJIJFFOK-PHYPRBDBSA-N alpha-D-galactose Chemical compound OC[C@H]1O[C@H](O)[C@H](O)[C@@H](O)[C@H]1O WQZGKKKJIJFFOK-PHYPRBDBSA-N 0.000 description 2
- XCPGHVQEEXUHNC-UHFFFAOYSA-N amsacrine Chemical compound COC1=CC(NS(C)(=O)=O)=CC=C1NC1=C(C=CC=C2)C2=NC2=CC=CC=C12 XCPGHVQEEXUHNC-UHFFFAOYSA-N 0.000 description 2
- KZOWNALBTMILAP-JBMRGDGGSA-N ancitabine hydrochloride Chemical compound Cl.N=C1C=CN2[C@@H]3O[C@H](CO)[C@@H](O)[C@@H]3OC2=N1 KZOWNALBTMILAP-JBMRGDGGSA-N 0.000 description 2
- 230000001093 anti-cancer Effects 0.000 description 2
- 230000030741 antigen processing and presentation Effects 0.000 description 2
- 238000010913 antigen-directed enzyme pro-drug therapy Methods 0.000 description 2
- 229940041181 antineoplastic drug Drugs 0.000 description 2
- SGPJMFVJKNVPLI-CJXLBUIWSA-N aphig Chemical compound Cl.C1[C@@]23[C@@]4(C)CC[C@@H](O)[C@@](C)(CO)[C@@H]4CC[C@H]3C[C@H]1[C@](COC(=O)CN)(O)CC2 SGPJMFVJKNVPLI-CJXLBUIWSA-N 0.000 description 2
- 230000006907 apoptotic process Effects 0.000 description 2
- 108010044540 auristatin Proteins 0.000 description 2
- DVQHYTBCTGYNNN-UHFFFAOYSA-N azane;cyclobutane-1,1-dicarboxylic acid;platinum Chemical compound N.N.[Pt].OC(=O)C1(C(O)=O)CCC1 DVQHYTBCTGYNNN-UHFFFAOYSA-N 0.000 description 2
- 230000009286 beneficial effect Effects 0.000 description 2
- 108010005774 beta-Galactosidase Proteins 0.000 description 2
- 230000001588 bifunctional effect Effects 0.000 description 2
- 230000033228 biological regulation Effects 0.000 description 2
- YWCASUPWYFFUHE-UHFFFAOYSA-N bis(3-methylsulfonyloxypropyl)azanium;chloride Chemical compound [Cl-].CS(=O)(=O)OCCC[NH2+]CCCOS(C)(=O)=O YWCASUPWYFFUHE-UHFFFAOYSA-N 0.000 description 2
- 229960001561 bleomycin Drugs 0.000 description 2
- OYVAGSVQBOHSSS-UAPAGMARSA-O bleomycin A2 Chemical compound N([C@H](C(=O)N[C@H](C)[C@@H](O)[C@H](C)C(=O)N[C@@H]([C@H](O)C)C(=O)NCCC=1SC=C(N=1)C=1SC=C(N=1)C(=O)NCCC[S+](C)C)[C@@H](O[C@H]1[C@H]([C@@H](O)[C@H](O)[C@H](CO)O1)O[C@@H]1[C@H]([C@@H](OC(N)=O)[C@H](O)[C@@H](CO)O1)O)C=1N=CNC=1)C(=O)C1=NC([C@H](CC(N)=O)NC[C@H](N)C(N)=O)=NC(N)=C1C OYVAGSVQBOHSSS-UAPAGMARSA-O 0.000 description 2
- 210000001185 bone marrow Anatomy 0.000 description 2
- PHEZJEYUWHETKO-UHFFFAOYSA-N brequinar Chemical compound N1=C2C=CC(F)=CC2=C(C(O)=O)C(C)=C1C(C=C1)=CC=C1C1=CC=CC=C1F PHEZJEYUWHETKO-UHFFFAOYSA-N 0.000 description 2
- 239000011575 calcium Substances 0.000 description 2
- 239000001506 calcium phosphate Substances 0.000 description 2
- 229910000389 calcium phosphate Inorganic materials 0.000 description 2
- 235000011010 calcium phosphates Nutrition 0.000 description 2
- 229940127093 camptothecin Drugs 0.000 description 2
- 239000000969 carrier Substances 0.000 description 2
- 238000004113 cell culture Methods 0.000 description 2
- 230000001413 cellular effect Effects 0.000 description 2
- 230000008859 change Effects 0.000 description 2
- 239000002738 chelating agent Substances 0.000 description 2
- HZCWPKGYTCJSEB-UHFFFAOYSA-N chembl118841 Chemical compound C12=CC(OC)=CC=C2NC2=C([N+]([O-])=O)C=CC3=C2C1=NN3CCCN(C)C HZCWPKGYTCJSEB-UHFFFAOYSA-N 0.000 description 2
- KPMVHELZNRNSMN-UHFFFAOYSA-N chembl1985849 Chemical compound N1=CC=C2NCCN21 KPMVHELZNRNSMN-UHFFFAOYSA-N 0.000 description 2
- LJHGXGDHNOZLFT-XCVCLJGOSA-N chembl331656 Chemical compound N\C(S)=N\N=C\C1=CC=C(O)C=N1 LJHGXGDHNOZLFT-XCVCLJGOSA-N 0.000 description 2
- 239000003153 chemical reaction reagent Substances 0.000 description 2
- 230000000973 chemotherapeutic effect Effects 0.000 description 2
- JCKYGMPEJWAADB-UHFFFAOYSA-N chlorambucil Chemical compound OC(=O)CCCC1=CC=C(N(CCCl)CCCl)C=C1 JCKYGMPEJWAADB-UHFFFAOYSA-N 0.000 description 2
- 238000010367 cloning Methods 0.000 description 2
- 229960001338 colchicine Drugs 0.000 description 2
- 230000021615 conjugation Effects 0.000 description 2
- 239000003431 cross linking reagent Substances 0.000 description 2
- 230000001461 cytolytic effect Effects 0.000 description 2
- 230000003013 cytotoxicity Effects 0.000 description 2
- 231100000135 cytotoxicity Toxicity 0.000 description 2
- 230000006378 damage Effects 0.000 description 2
- 229960000975 daunorubicin Drugs 0.000 description 2
- 230000002939 deleterious effect Effects 0.000 description 2
- 238000001212 derivatisation Methods 0.000 description 2
- 238000003745 diagnosis Methods 0.000 description 2
- WVYXNIXAMZOZFK-UHFFFAOYSA-N diaziquone Chemical compound O=C1C(NC(=O)OCC)=C(N2CC2)C(=O)C(NC(=O)OCC)=C1N1CC1 WVYXNIXAMZOZFK-UHFFFAOYSA-N 0.000 description 2
- 239000000539 dimer Substances 0.000 description 2
- ZLFRJHOBQVVTOJ-UHFFFAOYSA-N dimethyl hexanediimidate Chemical compound COC(=N)CCCCC(=N)OC ZLFRJHOBQVVTOJ-UHFFFAOYSA-N 0.000 description 2
- 208000035475 disorder Diseases 0.000 description 2
- VSJKWCGYPAHWDS-UHFFFAOYSA-N dl-camptothecin Natural products C1=CC=C2C=C(CN3C4=CC5=C(C3=O)COC(=O)C5(O)CC)C4=NC2=C1 VSJKWCGYPAHWDS-UHFFFAOYSA-N 0.000 description 2
- 108010045524 dolastatin 10 Proteins 0.000 description 2
- 230000002255 enzymatic effect Effects 0.000 description 2
- 210000003743 erythrocyte Anatomy 0.000 description 2
- VJJPUSNTGOMMGY-MRVIYFEKSA-N etoposide Chemical compound COC1=C(O)C(OC)=CC([C@@H]2C3=CC=4OCOC=4C=C3[C@@H](O[C@H]3[C@@H]([C@@H](O)[C@@H]4O[C@H](C)OC[C@H]4O3)O)[C@@H]3[C@@H]2C(OC3)=O)=C1 VJJPUSNTGOMMGY-MRVIYFEKSA-N 0.000 description 2
- ODKNJVUHOIMIIZ-RRKCRQDMSA-N floxuridine Chemical compound C1[C@H](O)[C@@H](CO)O[C@H]1N1C(=O)NC(=O)C(F)=C1 ODKNJVUHOIMIIZ-RRKCRQDMSA-N 0.000 description 2
- 229960002949 fluorouracil Drugs 0.000 description 2
- 125000000524 functional group Chemical group 0.000 description 2
- 238000012239 gene modification Methods 0.000 description 2
- 238000001415 gene therapy Methods 0.000 description 2
- 230000005017 genetic modification Effects 0.000 description 2
- 235000013617 genetically modified food Nutrition 0.000 description 2
- PKWIYNIDEDLDCJ-UHFFFAOYSA-N guanazole Chemical compound NC1=NNC(N)=N1 PKWIYNIDEDLDCJ-UHFFFAOYSA-N 0.000 description 2
- 210000003958 hematopoietic stem cell Anatomy 0.000 description 2
- 229920001519 homopolymer Polymers 0.000 description 2
- MFZWMTSUNYWVBU-UHFFFAOYSA-N hycanthone Chemical compound S1C2=CC=CC=C2C(=O)C2=C1C(CO)=CC=C2NCCN(CC)CC MFZWMTSUNYWVBU-UHFFFAOYSA-N 0.000 description 2
- FDGQSTZJBFJUBT-UHFFFAOYSA-N hypoxanthine Chemical compound O=C1NC=NC2=C1NC=N2 FDGQSTZJBFJUBT-UHFFFAOYSA-N 0.000 description 2
- 230000001900 immune effect Effects 0.000 description 2
- 230000005847 immunogenicity Effects 0.000 description 2
- 230000002637 immunotoxin Effects 0.000 description 2
- 229940051026 immunotoxin Drugs 0.000 description 2
- 239000002596 immunotoxin Substances 0.000 description 2
- 231100000608 immunotoxin Toxicity 0.000 description 2
- 230000008676 import Effects 0.000 description 2
- 230000006872 improvement Effects 0.000 description 2
- 208000015181 infectious disease Diseases 0.000 description 2
- 238000001802 infusion Methods 0.000 description 2
- 230000010354 integration Effects 0.000 description 2
- 238000002955 isolation Methods 0.000 description 2
- 238000012004 kinetic exclusion assay Methods 0.000 description 2
- 210000001165 lymph node Anatomy 0.000 description 2
- 239000011777 magnesium Substances 0.000 description 2
- 238000002595 magnetic resonance imaging Methods 0.000 description 2
- 239000003550 marker Substances 0.000 description 2
- 239000000463 material Substances 0.000 description 2
- 230000035800 maturation Effects 0.000 description 2
- LWYJUZBXGAFFLP-OCNCTQISSA-N menogaril Chemical compound O1[C@@]2(C)[C@H](O)[C@@H](N(C)C)[C@H](O)[C@@H]1OC1=C3C(=O)C(C=C4C[C@@](C)(O)C[C@H](C4=C4O)OC)=C4C(=O)C3=C(O)C=C12 LWYJUZBXGAFFLP-OCNCTQISSA-N 0.000 description 2
- 229960000485 methotrexate Drugs 0.000 description 2
- HRHKSTOGXBBQCB-VFWICMBZSA-N methylmitomycin Chemical compound O=C1C(N)=C(C)C(=O)C2=C1[C@@H](COC(N)=O)[C@@]1(OC)[C@H]3N(C)[C@H]3CN12 HRHKSTOGXBBQCB-VFWICMBZSA-N 0.000 description 2
- 229960004857 mitomycin Drugs 0.000 description 2
- QXYYYPFGTSJXNS-UHFFFAOYSA-N mitozolomide Chemical compound N1=NN(CCCl)C(=O)N2C1=C(C(=O)N)N=C2 QXYYYPFGTSJXNS-UHFFFAOYSA-N 0.000 description 2
- 238000010369 molecular cloning Methods 0.000 description 2
- 239000000178 monomer Substances 0.000 description 2
- 238000002703 mutagenesis Methods 0.000 description 2
- 231100000350 mutagenesis Toxicity 0.000 description 2
- UPBAOYRENQEPJO-UHFFFAOYSA-N n-[5-[[5-[(3-amino-3-iminopropyl)carbamoyl]-1-methylpyrrol-3-yl]carbamoyl]-1-methylpyrrol-3-yl]-4-formamido-1-methylpyrrole-2-carboxamide Chemical compound CN1C=C(NC=O)C=C1C(=O)NC1=CN(C)C(C(=O)NC2=CN(C)C(C(=O)NCCC(N)=N)=C2)=C1 UPBAOYRENQEPJO-UHFFFAOYSA-N 0.000 description 2
- 108010068617 neonatal Fc receptor Proteins 0.000 description 2
- 230000007935 neutral effect Effects 0.000 description 2
- 230000003000 nontoxic effect Effects 0.000 description 2
- 238000011275 oncology therapy Methods 0.000 description 2
- 229960001592 paclitaxel Drugs 0.000 description 2
- 210000005105 peripheral blood lymphocyte Anatomy 0.000 description 2
- NJBFOOCLYDNZJN-UHFFFAOYSA-N pipobroman Chemical compound BrCCC(=O)N1CCN(C(=O)CCBr)CC1 NJBFOOCLYDNZJN-UHFFFAOYSA-N 0.000 description 2
- XESARGFCSKSFID-FLLFQEBCSA-N pirazofurin Chemical compound OC1=C(C(=O)N)NN=C1[C@H]1[C@H](O)[C@H](O)[C@@H](CO)O1 XESARGFCSKSFID-FLLFQEBCSA-N 0.000 description 2
- 229920002451 polyvinyl alcohol Polymers 0.000 description 2
- 239000000047 product Substances 0.000 description 2
- 230000035755 proliferation Effects 0.000 description 2
- 230000008707 rearrangement Effects 0.000 description 2
- 230000009467 reduction Effects 0.000 description 2
- 210000003289 regulatory T cell Anatomy 0.000 description 2
- 238000012216 screening Methods 0.000 description 2
- 230000035945 sensitivity Effects 0.000 description 2
- 238000000926 separation method Methods 0.000 description 2
- 238000012163 sequencing technique Methods 0.000 description 2
- 238000004904 shortening Methods 0.000 description 2
- 238000001542 size-exclusion chromatography Methods 0.000 description 2
- 230000009870 specific binding Effects 0.000 description 2
- 210000000952 spleen Anatomy 0.000 description 2
- 239000003381 stabilizer Substances 0.000 description 2
- 238000002198 surface plasmon resonance spectroscopy Methods 0.000 description 2
- 208000024891 symptom Diseases 0.000 description 2
- NRUKOCRGYNPUPR-QBPJDGROSA-N teniposide Chemical compound COC1=C(O)C(OC)=CC([C@@H]2C3=CC=4OCOC=4C=C3[C@@H](O[C@H]3[C@@H]([C@@H](O)[C@@H]4O[C@@H](OC[C@H]4O3)C=3SC=CC=3)O)[C@@H]3[C@@H]2C(OC3)=O)=C1 NRUKOCRGYNPUPR-QBPJDGROSA-N 0.000 description 2
- 238000012360 testing method Methods 0.000 description 2
- 229960003087 tioguanine Drugs 0.000 description 2
- 238000001890 transfection Methods 0.000 description 2
- 230000009261 transgenic effect Effects 0.000 description 2
- 230000014616 translation Effects 0.000 description 2
- IUCJMVBFZDHPDX-UHFFFAOYSA-N tretamine Chemical compound C1CN1C1=NC(N2CC2)=NC(N2CC2)=N1 IUCJMVBFZDHPDX-UHFFFAOYSA-N 0.000 description 2
- QORWJWZARLRLPR-UHFFFAOYSA-H tricalcium bis(phosphate) Chemical compound [Ca+2].[Ca+2].[Ca+2].[O-]P([O-])([O-])=O.[O-]P([O-])([O-])=O QORWJWZARLRLPR-UHFFFAOYSA-H 0.000 description 2
- 210000003171 tumor-infiltrating lymphocyte Anatomy 0.000 description 2
- 238000011144 upstream manufacturing Methods 0.000 description 2
- 206010046885 vaginal cancer Diseases 0.000 description 2
- 208000013139 vaginal neoplasm Diseases 0.000 description 2
- 239000004474 valine Substances 0.000 description 2
- 239000003981 vehicle Substances 0.000 description 2
- AQTQHPDCURKLKT-JKDPCDLQSA-N vincristine sulfate Chemical compound OS(O)(=O)=O.C([C@@H](C[C@]1(C(=O)OC)C=2C(=CC3=C([C@]45[C@H]([C@@]([C@H](OC(C)=O)[C@]6(CC)C=CCN([C@H]56)CC4)(O)C(=O)OC)N3C=O)C=2)OC)C[C@@](C2)(O)CC)N2CCC2=C1NC1=CC=CC=C21 AQTQHPDCURKLKT-JKDPCDLQSA-N 0.000 description 2
- 230000003612 virological effect Effects 0.000 description 2
- 201000005102 vulva cancer Diseases 0.000 description 2
- 238000005406 washing Methods 0.000 description 2
- XLYOFNOQVPJJNP-UHFFFAOYSA-N water Substances O XLYOFNOQVPJJNP-UHFFFAOYSA-N 0.000 description 2
- 229920003169 water-soluble polymer Polymers 0.000 description 2
- QCWXUUIWCKQGHC-YPZZEJLDSA-N zirconium-89 Chemical compound [89Zr] QCWXUUIWCKQGHC-YPZZEJLDSA-N 0.000 description 2
- SFLSHLFXELFNJZ-QMMMGPOBSA-N (-)-norepinephrine Chemical compound NC[C@H](O)C1=CC=C(O)C(O)=C1 SFLSHLFXELFNJZ-QMMMGPOBSA-N 0.000 description 1
- HZSBSRAVNBUZRA-RQDPQJJXSA-J (1r,2r)-cyclohexane-1,2-diamine;tetrachloroplatinum(2+) Chemical compound Cl[Pt+2](Cl)(Cl)Cl.N[C@@H]1CCCC[C@H]1N HZSBSRAVNBUZRA-RQDPQJJXSA-J 0.000 description 1
- AAFJXZWCNVJTMK-GUCUJZIJSA-N (1s,2r)-1-[(2s)-oxiran-2-yl]-2-[(2r)-oxiran-2-yl]ethane-1,2-diol Chemical compound C([C@@H]1[C@H](O)[C@H](O)[C@H]2OC2)O1 AAFJXZWCNVJTMK-GUCUJZIJSA-N 0.000 description 1
- JKHVDAUOODACDU-UHFFFAOYSA-N (2,5-dioxopyrrolidin-1-yl) 3-(2,5-dioxopyrrol-1-yl)propanoate Chemical compound O=C1CCC(=O)N1OC(=O)CCN1C(=O)C=CC1=O JKHVDAUOODACDU-UHFFFAOYSA-N 0.000 description 1
- PVGATNRYUYNBHO-UHFFFAOYSA-N (2,5-dioxopyrrolidin-1-yl) 4-(2,5-dioxopyrrol-1-yl)butanoate Chemical compound O=C1CCC(=O)N1OC(=O)CCCN1C(=O)C=CC1=O PVGATNRYUYNBHO-UHFFFAOYSA-N 0.000 description 1
- BQWBEDSJTMWJAE-UHFFFAOYSA-N (2,5-dioxopyrrolidin-1-yl) 4-[(2-iodoacetyl)amino]benzoate Chemical compound C1=CC(NC(=O)CI)=CC=C1C(=O)ON1C(=O)CCC1=O BQWBEDSJTMWJAE-UHFFFAOYSA-N 0.000 description 1
- PMJWDPGOWBRILU-UHFFFAOYSA-N (2,5-dioxopyrrolidin-1-yl) 4-[4-(2,5-dioxopyrrol-1-yl)phenyl]butanoate Chemical compound O=C1CCC(=O)N1OC(=O)CCCC(C=C1)=CC=C1N1C(=O)C=CC1=O PMJWDPGOWBRILU-UHFFFAOYSA-N 0.000 description 1
- VLARLSIGSPVYHX-UHFFFAOYSA-N (2,5-dioxopyrrolidin-1-yl) 6-(2,5-dioxopyrrol-1-yl)hexanoate Chemical compound O=C1CCC(=O)N1OC(=O)CCCCCN1C(=O)C=CC1=O VLARLSIGSPVYHX-UHFFFAOYSA-N 0.000 description 1
- WCMOHMXWOOBVMZ-UHFFFAOYSA-N (2,5-dioxopyrrolidin-1-yl) 6-[3-(2,5-dioxopyrrol-1-yl)propanoylamino]hexanoate Chemical compound O=C1CCC(=O)N1OC(=O)CCCCCNC(=O)CCN1C(=O)C=CC1=O WCMOHMXWOOBVMZ-UHFFFAOYSA-N 0.000 description 1
- NNWOGVOYLDMOAZ-UHFFFAOYSA-L (2-azanidylcyclohexyl)azanide;benzene-1,2,4-tricarboxylate;hydron;platinum(4+) Chemical compound [H+].[Pt+4].[NH-]C1CCCCC1[NH-].[O-]C(=O)C1=CC=C(C([O-])=O)C(C([O-])=O)=C1 NNWOGVOYLDMOAZ-UHFFFAOYSA-L 0.000 description 1
- IDNIKXCEUZXOCR-UHFFFAOYSA-N (2-azanidylcyclohexyl)azanide;benzene-1,2,4-tricarboxylic acid;platinum(2+) Chemical compound [Pt+2].[NH-]C1CCCCC1[NH-].OC(=O)C1=CC=C(C(O)=O)C(C(O)=O)=C1 IDNIKXCEUZXOCR-UHFFFAOYSA-N 0.000 description 1
- RGWOFTGZWJGPHG-NKWVEPMBSA-N (2r)-3-hydroxy-2-[(1r)-2-oxo-1-(6-oxo-3h-purin-9-yl)ethoxy]propanal Chemical compound N1C=NC(=O)C2=C1N([C@@H](C=O)O[C@H](CO)C=O)C=N2 RGWOFTGZWJGPHG-NKWVEPMBSA-N 0.000 description 1
- RCFNNLSZHVHCEK-IMHLAKCZSA-N (7s,9s)-7-(4-amino-6-methyloxan-2-yl)oxy-6,9,11-trihydroxy-9-(2-hydroxyacetyl)-4-methoxy-8,10-dihydro-7h-tetracene-5,12-dione;hydrochloride Chemical compound [Cl-].O([C@H]1C[C@@](O)(CC=2C(O)=C3C(=O)C=4C=CC=C(C=4C(=O)C3=C(O)C=21)OC)C(=O)CO)C1CC([NH3+])CC(C)O1 RCFNNLSZHVHCEK-IMHLAKCZSA-N 0.000 description 1
- CFPUQMKLKLOWBL-OJWBPHNRSA-N (7s,9s)-9-acetyl-7-[(2r,4s,5s,6s)-4-(dibenzylamino)-5-hydroxy-6-methyloxan-2-yl]oxy-6,9,11-trihydroxy-4-methoxy-8,10-dihydro-7h-tetracene-5,12-dione;hydrochloride Chemical compound Cl.C=1C=CC=CC=1CN([C@H]1C[C@@H](O[C@@H](C)[C@H]1O)O[C@H]1C[C@@](O)(CC=2C(O)=C3C(=O)C=4C=CC=C(C=4C(=O)C3=C(O)C=21)OC)C(C)=O)CC1=CC=CC=C1 CFPUQMKLKLOWBL-OJWBPHNRSA-N 0.000 description 1
- AAFJXZWCNVJTMK-UHFFFAOYSA-N 1,2-bis(oxiran-2-yl)ethane-1,2-diol Chemical compound C1OC1C(O)C(O)C1CO1 AAFJXZWCNVJTMK-UHFFFAOYSA-N 0.000 description 1
- FJQZXCPWAGYPSD-UHFFFAOYSA-N 1,3,4,6-tetrachloro-3a,6a-diphenylimidazo[4,5-d]imidazole-2,5-dione Chemical compound ClN1C(=O)N(Cl)C2(C=3C=CC=CC=3)N(Cl)C(=O)N(Cl)C12C1=CC=CC=C1 FJQZXCPWAGYPSD-UHFFFAOYSA-N 0.000 description 1
- VILFTWLXLYIEMV-UHFFFAOYSA-N 1,5-difluoro-2,4-dinitrobenzene Chemical compound [O-][N+](=O)C1=CC([N+]([O-])=O)=C(F)C=C1F VILFTWLXLYIEMV-UHFFFAOYSA-N 0.000 description 1
- MKQWTWSXVILIKJ-UHFFFAOYSA-N 1-(2-chloroethyl)-1-nitroso-3-(3,4,5,6-tetrahydroxy-1-oxohexan-2-yl)urea Chemical compound OCC(O)C(O)C(O)C(C=O)NC(=O)N(N=O)CCCl MKQWTWSXVILIKJ-UHFFFAOYSA-N 0.000 description 1
- DIYPCWKHSODVAP-UHFFFAOYSA-N 1-[3-(2,5-dioxopyrrol-1-yl)benzoyl]oxy-2,5-dioxopyrrolidine-3-sulfonic acid Chemical compound O=C1C(S(=O)(=O)O)CC(=O)N1OC(=O)C1=CC=CC(N2C(C=CC2=O)=O)=C1 DIYPCWKHSODVAP-UHFFFAOYSA-N 0.000 description 1
- CULQNACJHGHAER-UHFFFAOYSA-N 1-[4-[(2-iodoacetyl)amino]benzoyl]oxy-2,5-dioxopyrrolidine-3-sulfonic acid Chemical compound O=C1C(S(=O)(=O)O)CC(=O)N1OC(=O)C1=CC=C(NC(=O)CI)C=C1 CULQNACJHGHAER-UHFFFAOYSA-N 0.000 description 1
- HAWSQZCWOQZXHI-FQEVSTJZSA-N 10-Hydroxycamptothecin Chemical compound C1=C(O)C=C2C=C(CN3C4=CC5=C(C3=O)COC(=O)[C@]5(O)CC)C4=NC2=C1 HAWSQZCWOQZXHI-FQEVSTJZSA-N 0.000 description 1
- PNDPGZBMCMUPRI-HVTJNCQCSA-N 10043-66-0 Chemical compound [131I][131I] PNDPGZBMCMUPRI-HVTJNCQCSA-N 0.000 description 1
- AMDHQGZVCWWZCS-UHFFFAOYSA-N 109466-93-5 Chemical compound O=CC1=CC=C2C=C(CN3C4=CC5=C(C3=O)COC(=O)C5(O)CC)C4=NC2=C1 AMDHQGZVCWWZCS-UHFFFAOYSA-N 0.000 description 1
- ASVIEXKOXDCZDF-QFIPXVFZSA-N 1v364427ug Chemical compound C1=CC=C2C=C(CN3C4=CC5=C(C3=O)COC(=O)[C@]5(OC(C)=O)CC)C4=NC2=C1 ASVIEXKOXDCZDF-QFIPXVFZSA-N 0.000 description 1
- YBBNVCVOACOHIG-UHFFFAOYSA-N 2,2-diamino-1,4-bis(4-azidophenyl)-3-butylbutane-1,4-dione Chemical compound C=1C=C(N=[N+]=[N-])C=CC=1C(=O)C(N)(N)C(CCCC)C(=O)C1=CC=C(N=[N+]=[N-])C=C1 YBBNVCVOACOHIG-UHFFFAOYSA-N 0.000 description 1
- NYQPLPNEESYGNO-IBGZPJMESA-N 2-[[(4s)-4-carboxy-4-[[4-[(2,4-diaminopteridin-6-yl)methylamino]benzoyl]amino]butyl]carbamoyl]benzoic acid Chemical compound C([C@H](NC(=O)C1=CC=C(C=C1)NCC1=NC2=C(N)N=C(N=C2N=C1)N)C(O)=O)CCNC(=O)C1=CC=CC=C1C(O)=O NYQPLPNEESYGNO-IBGZPJMESA-N 0.000 description 1
- FZDFGHZZPBUTGP-UHFFFAOYSA-N 2-[[2-[bis(carboxymethyl)amino]-3-(4-isothiocyanatophenyl)propyl]-[2-[bis(carboxymethyl)amino]propyl]amino]acetic acid Chemical compound OC(=O)CN(CC(O)=O)C(C)CN(CC(O)=O)CC(N(CC(O)=O)CC(O)=O)CC1=CC=C(N=C=S)C=C1 FZDFGHZZPBUTGP-UHFFFAOYSA-N 0.000 description 1
- MALRUKQRDHTJPO-UHFFFAOYSA-N 2-[[4-[(2,4-diamino-5-ethylquinazolin-6-yl)methylamino]benzoyl]amino]butanedioic acid Chemical compound C1=CC2=NC(N)=NC(N)=C2C(CC)=C1CNC1=CC=C(C(=O)NC(CC(O)=O)C(O)=O)C=C1 MALRUKQRDHTJPO-UHFFFAOYSA-N 0.000 description 1
- SCVJRXQHFJXZFZ-JKUQZMGJSA-N 2-amino-9-[(2s,4s,5r)-4-hydroxy-5-(hydroxymethyl)oxolan-2-yl]-3h-purine-6-thione Chemical compound C1=2NC(N)=NC(=S)C=2N=CN1[C@@H]1C[C@H](O)[C@@H](CO)O1 SCVJRXQHFJXZFZ-JKUQZMGJSA-N 0.000 description 1
- SCVJRXQHFJXZFZ-UHFFFAOYSA-N 2-amino-9-[4-hydroxy-5-(hydroxymethyl)oxolan-2-yl]-3h-purine-6-thione Chemical compound C1=2NC(N)=NC(=S)C=2N=CN1C1CC(O)C(CO)O1 SCVJRXQHFJXZFZ-UHFFFAOYSA-N 0.000 description 1
- WVCHIGAIXREVNS-UHFFFAOYSA-N 2-hydroxy-1,4-naphthoquinone Chemical compound C1=CC=C2C(O)=CC(=O)C(=O)C2=C1 WVCHIGAIXREVNS-UHFFFAOYSA-N 0.000 description 1
- YIMDLWDNDGKDTJ-QLKYHASDSA-N 3'-deamino-3'-(3-cyanomorpholin-4-yl)doxorubicin Chemical compound N1([C@H]2C[C@@H](O[C@@H](C)[C@H]2O)O[C@H]2C[C@@](O)(CC=3C(O)=C4C(=O)C=5C=CC=C(C=5C(=O)C4=C(O)C=32)OC)C(=O)CO)CCOCC1C#N YIMDLWDNDGKDTJ-QLKYHASDSA-N 0.000 description 1
- NDMPLJNOPCLANR-UHFFFAOYSA-N 3,4-dihydroxy-15-(4-hydroxy-18-methoxycarbonyl-5,18-seco-ibogamin-18-yl)-16-methoxy-1-methyl-6,7-didehydro-aspidospermidine-3-carboxylic acid methyl ester Natural products C1C(CC)(O)CC(CC2(C(=O)OC)C=3C(=CC4=C(C56C(C(C(O)C7(CC)C=CCN(C67)CC5)(O)C(=O)OC)N4C)C=3)OC)CN1CCC1=C2NC2=CC=CC=C12 NDMPLJNOPCLANR-UHFFFAOYSA-N 0.000 description 1
- LWQZLQISFLBSGW-UHFFFAOYSA-N 3-(3,3-dichloroprop-2-enyl)-4-hydroxynaphthalene-1,2-dione Chemical compound C1=CC=C2C(O)=C(CC=C(Cl)Cl)C(=O)C(=O)C2=C1 LWQZLQISFLBSGW-UHFFFAOYSA-N 0.000 description 1
- HKPVIFTWECXNPY-UHFFFAOYSA-N 3-[[2-chloro-4-(4,6-diamino-2,2-dimethyl-1,3,5-triazin-1-yl)phenoxy]methyl]-n,n-dimethylbenzamide;ethanesulfonic acid Chemical compound CCS(O)(=O)=O.CN(C)C(=O)C1=CC=CC(COC=2C(=CC(=CC=2)N2C(N=C(N)N=C2N)(C)C)Cl)=C1 HKPVIFTWECXNPY-UHFFFAOYSA-N 0.000 description 1
- QRYXYRQPMWQIDM-UHFFFAOYSA-N 3-benzoyl-3-(2,5-dioxopyrrol-1-yl)-1-hydroxypyrrolidine-2,5-dione Chemical compound O=C1N(O)C(=O)CC1(C(=O)C=1C=CC=CC=1)N1C(=O)C=CC1=O QRYXYRQPMWQIDM-UHFFFAOYSA-N 0.000 description 1
- XKTYXVDYIKIYJP-UHFFFAOYSA-N 3h-dioxole Chemical compound C1OOC=C1 XKTYXVDYIKIYJP-UHFFFAOYSA-N 0.000 description 1
- BTQAFTBKHVLPEV-UHFFFAOYSA-N 3h-naphtho[2,3-e]indazole Chemical class C1=CC=CC2=CC3=C4C=NNC4=CC=C3C=C21 BTQAFTBKHVLPEV-UHFFFAOYSA-N 0.000 description 1
- YUJSWFZLUCHGFO-UHFFFAOYSA-N 4-(4-azidophenyl)aniline Chemical compound C1=CC(N)=CC=C1C1=CC=C(N=[N+]=[N-])C=C1 YUJSWFZLUCHGFO-UHFFFAOYSA-N 0.000 description 1
- YIMDLWDNDGKDTJ-ABYLTEMBSA-N 4-[(2s,3s,4s)-3-hydroxy-2-methyl-6-[[(1s,3s)-3,5,12-trihydroxy-3-(2-hydroxyacetyl)-10-methoxy-6,11-dioxo-2,4-dihydro-1h-tetracen-1-yl]oxy]oxan-4-yl]morpholine-3-carbonitrile Chemical compound N1([C@H]2CC(O[C@@H](C)[C@H]2O)O[C@H]2C[C@@](O)(CC=3C(O)=C4C(=O)C=5C=CC=C(C=5C(=O)C4=C(O)C=32)OC)C(=O)CO)CCOCC1C#N YIMDLWDNDGKDTJ-ABYLTEMBSA-N 0.000 description 1
- ZMRMMAOBSFSXLN-UHFFFAOYSA-N 4-[4-(2,5-dioxopyrrol-1-yl)phenyl]butanehydrazide Chemical compound C1=CC(CCCC(=O)NN)=CC=C1N1C(=O)C=CC1=O ZMRMMAOBSFSXLN-UHFFFAOYSA-N 0.000 description 1
- UHDGCWIWMRVCDJ-UHFFFAOYSA-N 4-amino-1-[3,4-dihydroxy-5-(hydroxymethyl)oxolan-2-yl]pyrimidin-2-one Chemical compound O=C1N=C(N)C=CN1C1C(O)C(O)C(CO)O1 UHDGCWIWMRVCDJ-UHFFFAOYSA-N 0.000 description 1
- 108020005029 5' Flanking Region Proteins 0.000 description 1
- NMUSYJAQQFHJEW-UHFFFAOYSA-N 5-Azacytidine Natural products O=C1N=C(N)N=CN1C1C(O)C(O)C(CO)O1 NMUSYJAQQFHJEW-UHFFFAOYSA-N 0.000 description 1
- ZCJXQWYMBJYJNB-LRDBBFHQSA-N 5-methyl-6-[(3,4,5-trimethoxyanilino)methyl]quinazoline-2,4-diamine;(2s,3s,4s,5r)-2,3,4,5-tetrahydroxy-6-oxohexanoic acid Chemical compound O=C[C@H](O)[C@@H](O)[C@H](O)[C@H](O)C(O)=O.COC1=C(OC)C(OC)=CC(NCC=2C(=C3C(N)=NC(N)=NC3=CC=2)C)=C1 ZCJXQWYMBJYJNB-LRDBBFHQSA-N 0.000 description 1
- LJIRBXZDQGQUOO-KVTDHHQDSA-N 6-amino-3-[(2r,3r,4s,5r)-3,4-dihydroxy-5-(hydroxymethyl)oxolan-2-yl]-1,4-dihydro-1,3,5-triazin-2-one Chemical compound C1NC(N)=NC(=O)N1[C@H]1[C@H](O)[C@H](O)[C@@H](CO)O1 LJIRBXZDQGQUOO-KVTDHHQDSA-N 0.000 description 1
- 102100023990 60S ribosomal protein L17 Human genes 0.000 description 1
- KUAKYFCHUDSMNU-UHFFFAOYSA-N 7-chlorocamptothecin Chemical compound C1=CC=C2C(Cl)=C(CN3C4=CC5=C(C3=O)COC(=O)C5(O)CC)C4=NC2=C1 KUAKYFCHUDSMNU-UHFFFAOYSA-N 0.000 description 1
- ZCYVEMRRCGMTRW-UHFFFAOYSA-N 7553-56-2 Chemical compound [I] ZCYVEMRRCGMTRW-UHFFFAOYSA-N 0.000 description 1
- FUXVKZWTXQUGMW-UHFFFAOYSA-N 9-amino-20-(r,s)-camptothecin Chemical compound C1=CC(N)=C2C=C(CN3C4=CC5=C(C3=O)COC(=O)C5(O)CC)C4=NC2=C1 FUXVKZWTXQUGMW-UHFFFAOYSA-N 0.000 description 1
- XVMZDZFTCKLZTF-NRFANRHFSA-N 9-methoxycamptothecin Chemical compound C1=CC(OC)=C2C=C(CN3C4=CC5=C(C3=O)COC(=O)[C@]5(O)CC)C4=NC2=C1 XVMZDZFTCKLZTF-NRFANRHFSA-N 0.000 description 1
- 102100031585 ADP-ribosyl cyclase/cyclic ADP-ribose hydrolase 1 Human genes 0.000 description 1
- 108010066676 Abrin Proteins 0.000 description 1
- 108010085238 Actins Proteins 0.000 description 1
- 102000007469 Actins Human genes 0.000 description 1
- 229930024421 Adenine Natural products 0.000 description 1
- GFFGJBXGBJISGV-UHFFFAOYSA-N Adenine Chemical compound NC1=NC=NC2=C1N=CN2 GFFGJBXGBJISGV-UHFFFAOYSA-N 0.000 description 1
- NMKUAEKKJQYLHK-UHFFFAOYSA-N Allocolchicine Natural products CC(=O)NC1CCC2=CC(OC)=C(OC)C(OC)=C2C2=CC=C(C(=O)OC)C=C21 NMKUAEKKJQYLHK-UHFFFAOYSA-N 0.000 description 1
- 102100021266 Alpha-(1,6)-fucosyltransferase Human genes 0.000 description 1
- QGZKDVFQNNGYKY-OUBTZVSYSA-N Ammonia-15N Chemical compound [15NH3] QGZKDVFQNNGYKY-OUBTZVSYSA-N 0.000 description 1
- 102000006306 Antigen Receptors Human genes 0.000 description 1
- 108010083359 Antigen Receptors Proteins 0.000 description 1
- 108020005544 Antisense RNA Proteins 0.000 description 1
- 102000009133 Arylsulfatases Human genes 0.000 description 1
- NPDLYUOYAGBHFB-WDSKDSINSA-N Asn-Arg Chemical compound NC(=O)C[C@H](N)C(=O)N[C@H](C(O)=O)CCCN=C(N)N NPDLYUOYAGBHFB-WDSKDSINSA-N 0.000 description 1
- 208000023275 Autoimmune disease Diseases 0.000 description 1
- 241000714230 Avian leukemia virus Species 0.000 description 1
- 108090001008 Avidin Proteins 0.000 description 1
- 108091008875 B cell receptors Proteins 0.000 description 1
- 102100022005 B-lymphocyte antigen CD20 Human genes 0.000 description 1
- 231100000699 Bacterial toxin Toxicity 0.000 description 1
- DWRXFEITVBNRMK-UHFFFAOYSA-N Beta-D-1-Arabinofuranosylthymine Natural products O=C1NC(=O)C(C)=CN1C1C(O)C(O)C(CO)O1 DWRXFEITVBNRMK-UHFFFAOYSA-N 0.000 description 1
- 241000283690 Bos taurus Species 0.000 description 1
- 101150013553 CD40 gene Proteins 0.000 description 1
- 102100035793 CD83 antigen Human genes 0.000 description 1
- 102100037904 CD9 antigen Human genes 0.000 description 1
- 101100454808 Caenorhabditis elegans lgg-2 gene Proteins 0.000 description 1
- 101100217502 Caenorhabditis elegans lgg-3 gene Proteins 0.000 description 1
- OYPRJOBELJOOCE-UHFFFAOYSA-N Calcium Chemical compound [Ca] OYPRJOBELJOOCE-UHFFFAOYSA-N 0.000 description 1
- 101710158575 Cap-specific mRNA (nucleoside-2'-O-)-methyltransferase Proteins 0.000 description 1
- OKTJSMMVPCPJKN-UHFFFAOYSA-N Carbon Chemical compound [C] OKTJSMMVPCPJKN-UHFFFAOYSA-N 0.000 description 1
- OKTJSMMVPCPJKN-OUBTZVSYSA-N Carbon-13 Chemical compound [13C] OKTJSMMVPCPJKN-OUBTZVSYSA-N 0.000 description 1
- OKTJSMMVPCPJKN-NJFSPNSNSA-N Carbon-14 Chemical compound [14C] OKTJSMMVPCPJKN-NJFSPNSNSA-N 0.000 description 1
- 229920002134 Carboxymethyl cellulose Polymers 0.000 description 1
- 108010006303 Carboxypeptidases Proteins 0.000 description 1
- 102000005367 Carboxypeptidases Human genes 0.000 description 1
- 102100025466 Carcinoembryonic antigen-related cell adhesion molecule 3 Human genes 0.000 description 1
- 201000009030 Carcinoma Diseases 0.000 description 1
- 102000000844 Cell Surface Receptors Human genes 0.000 description 1
- 108010001857 Cell Surface Receptors Proteins 0.000 description 1
- 102100025064 Cellular tumor antigen p53 Human genes 0.000 description 1
- 108010035563 Chloramphenicol O-acetyltransferase Proteins 0.000 description 1
- MKQWTWSXVILIKJ-LXGUWJNJSA-N Chlorozotocin Chemical compound OC[C@@H](O)[C@@H](O)[C@H](O)[C@H](C=O)NC(=O)N(N=O)CCCl MKQWTWSXVILIKJ-LXGUWJNJSA-N 0.000 description 1
- BTIDXNPBPKDZOX-AFGTVAMDSA-N Cl.Cl.Cl[C@H]1CC[C@@H](NC1)[C@@H]1NC(=O)[C@@H](NC1=O)[C@H]1CC[C@H](Cl)CN1 Chemical compound Cl.Cl.Cl[C@H]1CC[C@@H](NC1)[C@@H]1NC(=O)[C@@H](NC1=O)[C@H]1CC[C@H](Cl)CN1 BTIDXNPBPKDZOX-AFGTVAMDSA-N 0.000 description 1
- 108020004705 Codon Proteins 0.000 description 1
- 208000035473 Communicable disease Diseases 0.000 description 1
- 108091035707 Consensus sequence Proteins 0.000 description 1
- 102000004420 Creatine Kinase Human genes 0.000 description 1
- 108010042126 Creatine kinase Proteins 0.000 description 1
- 241000699800 Cricetinae Species 0.000 description 1
- 241000699802 Cricetulus griseus Species 0.000 description 1
- 108700032819 Croton tiglium crotin II Proteins 0.000 description 1
- 102000008130 Cyclic AMP-Dependent Protein Kinases Human genes 0.000 description 1
- 108010049894 Cyclic AMP-Dependent Protein Kinases Proteins 0.000 description 1
- UHDGCWIWMRVCDJ-CCXZUQQUSA-N Cytarabine Chemical compound O=C1N=C(N)C=CN1[C@H]1[C@@H](O)[C@H](O)[C@@H](CO)O1 UHDGCWIWMRVCDJ-CCXZUQQUSA-N 0.000 description 1
- 102000004127 Cytokines Human genes 0.000 description 1
- 108090000695 Cytokines Proteins 0.000 description 1
- 102000000311 Cytosine Deaminase Human genes 0.000 description 1
- 108010080611 Cytosine Deaminase Proteins 0.000 description 1
- IGXWBGJHJZYPQS-SSDOTTSWSA-N D-Luciferin Chemical compound OC(=O)[C@H]1CSC(C=2SC3=CC=C(O)C=C3N=2)=N1 IGXWBGJHJZYPQS-SSDOTTSWSA-N 0.000 description 1
- 102000053602 DNA Human genes 0.000 description 1
- 241000450599 DNA viruses Species 0.000 description 1
- 230000004568 DNA-binding Effects 0.000 description 1
- CYCGRDQQIOGCKX-UHFFFAOYSA-N Dehydro-luciferin Natural products OC(=O)C1=CSC(C=2SC3=CC(O)=CC=C3N=2)=N1 CYCGRDQQIOGCKX-UHFFFAOYSA-N 0.000 description 1
- 102000007260 Deoxyribonuclease I Human genes 0.000 description 1
- 108010008532 Deoxyribonuclease I Proteins 0.000 description 1
- 108090000204 Dipeptidase 1 Proteins 0.000 description 1
- 206010061818 Disease progression Diseases 0.000 description 1
- OFDNQWIFNXBECV-UHFFFAOYSA-N Dolastatin 10 Natural products CC(C)C(N(C)C)C(=O)NC(C(C)C)C(=O)N(C)C(C(C)CC)C(OC)CC(=O)N1CCCC1C(OC)C(C)C(=O)NC(C=1SC=CN=1)CC1=CC=CC=C1 OFDNQWIFNXBECV-UHFFFAOYSA-N 0.000 description 1
- MWWSFMDVAYGXBV-RUELKSSGSA-N Doxorubicin hydrochloride Chemical compound Cl.O([C@H]1C[C@@](O)(CC=2C(O)=C3C(=O)C=4C=CC=C(C=4C(=O)C3=C(O)C=21)OC)C(=O)CO)[C@H]1C[C@H](N)[C@H](O)[C@H](C)O1 MWWSFMDVAYGXBV-RUELKSSGSA-N 0.000 description 1
- 239000006144 Dulbecco’s modified Eagle's medium Substances 0.000 description 1
- 238000002965 ELISA Methods 0.000 description 1
- 241000588724 Escherichia coli Species 0.000 description 1
- 229930189413 Esperamicin Natural products 0.000 description 1
- 101710082714 Exotoxin A Proteins 0.000 description 1
- 206010073306 Exposure to radiation Diseases 0.000 description 1
- BJGNCJDXODQBOB-UHFFFAOYSA-N Fivefly Luciferin Natural products OC(=O)C1CSC(C=2SC3=CC(O)=CC=C3N=2)=N1 BJGNCJDXODQBOB-UHFFFAOYSA-N 0.000 description 1
- 229910052688 Gadolinium Inorganic materials 0.000 description 1
- JRZJKWGQFNTSRN-UHFFFAOYSA-N Geldanamycin Natural products C1C(C)CC(OC)C(O)C(C)C=C(C)C(OC(N)=O)C(OC)CCC=C(C)C(=O)NC2=CC(=O)C(OC)=C1C2=O JRZJKWGQFNTSRN-UHFFFAOYSA-N 0.000 description 1
- 108700039691 Genetic Promoter Regions Proteins 0.000 description 1
- 208000031448 Genomic Instability Diseases 0.000 description 1
- BCCRXDTUTZHDEU-VKHMYHEASA-N Gly-Ser Chemical group NCC(=O)N[C@@H](CO)C(O)=O BCCRXDTUTZHDEU-VKHMYHEASA-N 0.000 description 1
- DHMQDGOQFOQNFH-UHFFFAOYSA-N Glycine Chemical compound NCC(O)=O DHMQDGOQFOQNFH-UHFFFAOYSA-N 0.000 description 1
- 108010017213 Granulocyte-Macrophage Colony-Stimulating Factor Proteins 0.000 description 1
- 102100039620 Granulocyte-macrophage colony-stimulating factor Human genes 0.000 description 1
- 108010043121 Green Fluorescent Proteins Proteins 0.000 description 1
- 244000041633 Grewia tenax Species 0.000 description 1
- 235000005612 Grewia tenax Nutrition 0.000 description 1
- 208000031886 HIV Infections Diseases 0.000 description 1
- 208000037357 HIV infectious disease Diseases 0.000 description 1
- 101150118346 HLA-A gene Proteins 0.000 description 1
- 108010032218 HLA-A*23 antigen Proteins 0.000 description 1
- 108010089211 HLA-A*25 antigen Proteins 0.000 description 1
- 108010080347 HLA-A*26 antigen Proteins 0.000 description 1
- 108010041379 HLA-A*30 antigen Proteins 0.000 description 1
- 108010086091 HLA-A*80 Antigen Proteins 0.000 description 1
- 108010036972 HLA-A11 Antigen Proteins 0.000 description 1
- 108010013476 HLA-A24 Antigen Proteins 0.000 description 1
- 108010029526 HLA-A28 antigen Proteins 0.000 description 1
- 108010034115 HLA-A29 antigen Proteins 0.000 description 1
- 102000006354 HLA-DR Antigens Human genes 0.000 description 1
- 108010058597 HLA-DR Antigens Proteins 0.000 description 1
- ZBLLGPUWGCOJNG-UHFFFAOYSA-N Halichondrin B Natural products CC1CC2(CC(C)C3OC4(CC5OC6C(CC5O4)OC7CC8OC9CCC%10OC(CC(C(C9)C8=C)C%11%12CC%13OC%14C(OC%15CCC(CC(=O)OC7C6C)OC%15C%14O%11)C%13O%12)CC%10=C)CC3O2)OC%16OC(CC1%16)C(O)CC(O)CO ZBLLGPUWGCOJNG-UHFFFAOYSA-N 0.000 description 1
- 108010054147 Hemoglobins Proteins 0.000 description 1
- 102000001554 Hemoglobins Human genes 0.000 description 1
- 241000238631 Hexapoda Species 0.000 description 1
- 102100026122 High affinity immunoglobulin gamma Fc receptor I Human genes 0.000 description 1
- 101000777636 Homo sapiens ADP-ribosyl cyclase/cyclic ADP-ribose hydrolase 1 Proteins 0.000 description 1
- 101000819490 Homo sapiens Alpha-(1,6)-fucosyltransferase Proteins 0.000 description 1
- 101000897405 Homo sapiens B-lymphocyte antigen CD20 Proteins 0.000 description 1
- 101000946856 Homo sapiens CD83 antigen Proteins 0.000 description 1
- 101000738354 Homo sapiens CD9 antigen Proteins 0.000 description 1
- 101000914337 Homo sapiens Carcinoembryonic antigen-related cell adhesion molecule 3 Proteins 0.000 description 1
- 101000721661 Homo sapiens Cellular tumor antigen p53 Proteins 0.000 description 1
- 101100334515 Homo sapiens FCGR3A gene Proteins 0.000 description 1
- 101000913074 Homo sapiens High affinity immunoglobulin gamma Fc receptor I Proteins 0.000 description 1
- 101001057504 Homo sapiens Interferon-stimulated gene 20 kDa protein Proteins 0.000 description 1
- 101001055144 Homo sapiens Interleukin-2 receptor subunit alpha Proteins 0.000 description 1
- 101000777628 Homo sapiens Leukocyte antigen CD37 Proteins 0.000 description 1
- 101000878605 Homo sapiens Low affinity immunoglobulin epsilon Fc receptor Proteins 0.000 description 1
- 101000917824 Homo sapiens Low affinity immunoglobulin gamma Fc region receptor II-b Proteins 0.000 description 1
- 101000934338 Homo sapiens Myeloid cell surface antigen CD33 Proteins 0.000 description 1
- 101001109503 Homo sapiens NKG2-C type II integral membrane protein Proteins 0.000 description 1
- 101000738771 Homo sapiens Receptor-type tyrosine-protein phosphatase C Proteins 0.000 description 1
- 101000934341 Homo sapiens T-cell surface glycoprotein CD5 Proteins 0.000 description 1
- 101000946843 Homo sapiens T-cell surface glycoprotein CD8 alpha chain Proteins 0.000 description 1
- 101000914484 Homo sapiens T-lymphocyte activation antigen CD80 Proteins 0.000 description 1
- 101000851376 Homo sapiens Tumor necrosis factor receptor superfamily member 8 Proteins 0.000 description 1
- 101000621309 Homo sapiens Wilms tumor protein Proteins 0.000 description 1
- 108010001336 Horseradish Peroxidase Proteins 0.000 description 1
- 241000700588 Human alphaherpesvirus 1 Species 0.000 description 1
- 241000701044 Human gammaherpesvirus 4 Species 0.000 description 1
- UFHFLCQGNIYNRP-UHFFFAOYSA-N Hydrogen Chemical compound [H][H] UFHFLCQGNIYNRP-UHFFFAOYSA-N 0.000 description 1
- UGQMRVRMYYASKQ-UHFFFAOYSA-N Hypoxanthine nucleoside Natural products OC1C(O)C(CO)OC1N1C(NC=NC2=O)=C2N=C1 UGQMRVRMYYASKQ-UHFFFAOYSA-N 0.000 description 1
- 102000012745 Immunoglobulin Subunits Human genes 0.000 description 1
- 108010079585 Immunoglobulin Subunits Proteins 0.000 description 1
- UGQMRVRMYYASKQ-KQYNXXCUSA-N Inosine Chemical compound O[C@@H]1[C@H](O)[C@@H](CO)O[C@H]1N1C2=NC=NC(O)=C2N=C1 UGQMRVRMYYASKQ-KQYNXXCUSA-N 0.000 description 1
- 229930010555 Inosine Natural products 0.000 description 1
- 108010002350 Interleukin-2 Proteins 0.000 description 1
- 102000000588 Interleukin-2 Human genes 0.000 description 1
- 102100026878 Interleukin-2 receptor subunit alpha Human genes 0.000 description 1
- 108091092195 Intron Proteins 0.000 description 1
- MLFKVJCWGUZWNV-UHFFFAOYSA-N L-alanosine Natural products OC(=O)C(N)CN(O)N=O MLFKVJCWGUZWNV-UHFFFAOYSA-N 0.000 description 1
- QIVBCDIJIAJPQS-VIFPVBQESA-N L-tryptophane Chemical compound C1=CC=C2C(C[C@H](N)C(O)=O)=CNC2=C1 QIVBCDIJIAJPQS-VIFPVBQESA-N 0.000 description 1
- 125000000510 L-tryptophano group Chemical group [H]C1=C([H])C([H])=C2N([H])C([H])=C(C([H])([H])[C@@]([H])(C(O[H])=O)N([H])[*])C2=C1[H] 0.000 description 1
- 102100031586 Leukocyte antigen CD37 Human genes 0.000 description 1
- 239000000232 Lipid Bilayer Substances 0.000 description 1
- 102100038007 Low affinity immunoglobulin epsilon Fc receptor Human genes 0.000 description 1
- 102100029205 Low affinity immunoglobulin gamma Fc region receptor II-b Human genes 0.000 description 1
- 108060001084 Luciferase Proteins 0.000 description 1
- 239000005089 Luciferase Substances 0.000 description 1
- DDWFXDSYGUXRAY-UHFFFAOYSA-N Luciferin Natural products CCc1c(C)c(CC2NC(=O)C(=C2C=C)C)[nH]c1Cc3[nH]c4C(=C5/NC(CC(=O)O)C(C)C5CC(=O)O)CC(=O)c4c3C DDWFXDSYGUXRAY-UHFFFAOYSA-N 0.000 description 1
- 239000004472 Lysine Substances 0.000 description 1
- 101001133631 Lysinibacillus sphaericus Penicillin acylase Proteins 0.000 description 1
- 102000043131 MHC class II family Human genes 0.000 description 1
- 108091054438 MHC class II family Proteins 0.000 description 1
- SVSFCSOFEPJFSF-UHFFFAOYSA-N Macbecin II Natural products N1C(=O)C(C)=CC=CC(C)C(OC(N)=O)C(C)=CC(C)C(OC)C(OC)CC(C)C(OC)C2=CC(O)=CC1=C2O SVSFCSOFEPJFSF-UHFFFAOYSA-N 0.000 description 1
- FYYHWMGAXLPEAU-UHFFFAOYSA-N Magnesium Chemical compound [Mg] FYYHWMGAXLPEAU-UHFFFAOYSA-N 0.000 description 1
- 241000124008 Mammalia Species 0.000 description 1
- PWHULOQIROXLJO-UHFFFAOYSA-N Manganese Chemical compound [Mn] PWHULOQIROXLJO-UHFFFAOYSA-N 0.000 description 1
- 102000018697 Membrane Proteins Human genes 0.000 description 1
- SGDBTWWWUNNDEQ-UHFFFAOYSA-N Merphalan Chemical compound OC(=O)C(N)CC1=CC=C(N(CCCl)CCCl)C=C1 SGDBTWWWUNNDEQ-UHFFFAOYSA-N 0.000 description 1
- HRHKSTOGXBBQCB-UHFFFAOYSA-N Mitomycin E Natural products O=C1C(N)=C(C)C(=O)C2=C1C(COC(N)=O)C1(OC)C3N(C)C3CN12 HRHKSTOGXBBQCB-UHFFFAOYSA-N 0.000 description 1
- 244000302512 Momordica charantia Species 0.000 description 1
- 235000009811 Momordica charantia Nutrition 0.000 description 1
- 241000714177 Murine leukemia virus Species 0.000 description 1
- 101100226902 Mus musculus Fcrlb gene Proteins 0.000 description 1
- 102100025243 Myeloid cell surface antigen CD33 Human genes 0.000 description 1
- 108060008487 Myosin Proteins 0.000 description 1
- 102000003505 Myosin Human genes 0.000 description 1
- OVRNDRQMDRJTHS-FMDGEEDCSA-N N-acetyl-beta-D-glucosamine Chemical compound CC(=O)N[C@H]1[C@H](O)O[C@H](CO)[C@@H](O)[C@@H]1O OVRNDRQMDRJTHS-FMDGEEDCSA-N 0.000 description 1
- 230000006051 NK cell activation Effects 0.000 description 1
- 102100022683 NKG2-C type II integral membrane protein Human genes 0.000 description 1
- 102000005348 Neuraminidase Human genes 0.000 description 1
- 108010006232 Neuraminidase Proteins 0.000 description 1
- 238000000636 Northern blotting Methods 0.000 description 1
- 108091034117 Oligonucleotide Proteins 0.000 description 1
- 108020005187 Oligonucleotide Probes Proteins 0.000 description 1
- 108700020796 Oncogene Proteins 0.000 description 1
- 102000043276 Oncogene Human genes 0.000 description 1
- 108700026244 Open Reading Frames Proteins 0.000 description 1
- 238000012879 PET imaging Methods 0.000 description 1
- 229910019142 PO4 Inorganic materials 0.000 description 1
- 102100026450 POU domain, class 3, transcription factor 4 Human genes 0.000 description 1
- 101710133389 POU domain, class 3, transcription factor 4 Proteins 0.000 description 1
- 108010073038 Penicillin Amidase Proteins 0.000 description 1
- 101710123388 Penicillin G acylase Proteins 0.000 description 1
- 108010057150 Peplomycin Proteins 0.000 description 1
- 102000035195 Peptidases Human genes 0.000 description 1
- FSXRLASFHBWESK-HOTGVXAUSA-N Phe-Tyr Chemical compound C([C@H](N)C(=O)N[C@@H](CC=1C=CC(O)=CC=1)C(O)=O)C1=CC=CC=C1 FSXRLASFHBWESK-HOTGVXAUSA-N 0.000 description 1
- 101100413173 Phytolacca americana PAP2 gene Proteins 0.000 description 1
- 231100000742 Plant toxin Toxicity 0.000 description 1
- 208000002151 Pleural effusion Diseases 0.000 description 1
- 241000276498 Pollachius virens Species 0.000 description 1
- 101710089372 Programmed cell death protein 1 Proteins 0.000 description 1
- 102000001253 Protein Kinase Human genes 0.000 description 1
- 102000003923 Protein Kinase C Human genes 0.000 description 1
- 108090000315 Protein Kinase C Proteins 0.000 description 1
- 241000589517 Pseudomonas aeruginosa Species 0.000 description 1
- 108700033844 Pseudomonas aeruginosa toxA Proteins 0.000 description 1
- XESARGFCSKSFID-UHFFFAOYSA-N Pyrazofurin Natural products OC1=C(C(=O)N)NN=C1C1C(O)C(O)C(CO)O1 XESARGFCSKSFID-UHFFFAOYSA-N 0.000 description 1
- 239000012980 RPMI-1640 medium Substances 0.000 description 1
- 102100037422 Receptor-type tyrosine-protein phosphatase C Human genes 0.000 description 1
- 102100037486 Reverse transcriptase/ribonuclease H Human genes 0.000 description 1
- 241000219061 Rheum Species 0.000 description 1
- 108010083644 Ribonucleases Proteins 0.000 description 1
- 102000006382 Ribonucleases Human genes 0.000 description 1
- 241000714474 Rous sarcoma virus Species 0.000 description 1
- 240000004808 Saccharomyces cerevisiae Species 0.000 description 1
- 108010084592 Saporins Proteins 0.000 description 1
- 229920002684 Sepharose Polymers 0.000 description 1
- PPQRSMGDOHLTBE-UWVGGRQHSA-N Ser-Phe Chemical compound OC[C@H](N)C(=O)N[C@H](C(O)=O)CC1=CC=CC=C1 PPQRSMGDOHLTBE-UWVGGRQHSA-N 0.000 description 1
- XZKQVQKUZMAADP-IMJSIDKUSA-N Ser-Ser Chemical compound OC[C@H](N)C(=O)N[C@@H](CO)C(O)=O XZKQVQKUZMAADP-IMJSIDKUSA-N 0.000 description 1
- 241000607720 Serratia Species 0.000 description 1
- 108010003723 Single-Domain Antibodies Proteins 0.000 description 1
- FAPWRFPIFSIZLT-UHFFFAOYSA-M Sodium chloride Chemical compound [Na+].[Cl-] FAPWRFPIFSIZLT-UHFFFAOYSA-M 0.000 description 1
- 238000002105 Southern blotting Methods 0.000 description 1
- 241000269319 Squalius cephalus Species 0.000 description 1
- 108090000787 Subtilisin Proteins 0.000 description 1
- QAOWNCQODCNURD-UHFFFAOYSA-L Sulfate Chemical compound [O-]S([O-])(=O)=O QAOWNCQODCNURD-UHFFFAOYSA-L 0.000 description 1
- 230000010782 T cell mediated cytotoxicity Effects 0.000 description 1
- 102100025244 T-cell surface glycoprotein CD5 Human genes 0.000 description 1
- 102100027222 T-lymphocyte activation antigen CD80 Human genes 0.000 description 1
- WFWLQNSHRPWKFK-UHFFFAOYSA-N Tegafur Chemical compound O=C1NC(=O)C(F)=CN1C1OCCC1 WFWLQNSHRPWKFK-UHFFFAOYSA-N 0.000 description 1
- 239000004098 Tetracycline Substances 0.000 description 1
- 108090001109 Thermolysin Proteins 0.000 description 1
- DSGIVWSDDRDJIO-ZXXMMSQZSA-N Thr-Thr Chemical compound C[C@@H](O)[C@H](N)C(=O)N[C@@H]([C@@H](C)O)C(O)=O DSGIVWSDDRDJIO-ZXXMMSQZSA-N 0.000 description 1
- 108091036066 Three prime untranslated region Proteins 0.000 description 1
- 102000006601 Thymidine Kinase Human genes 0.000 description 1
- 108020004440 Thymidine kinase Proteins 0.000 description 1
- 108700019146 Transgenes Proteins 0.000 description 1
- 101000980463 Treponema pallidum (strain Nichols) Chaperonin GroEL Proteins 0.000 description 1
- QIVBCDIJIAJPQS-UHFFFAOYSA-N Tryptophan Natural products C1=CC=C2C(CC(N)C(O)=O)=CNC2=C1 QIVBCDIJIAJPQS-UHFFFAOYSA-N 0.000 description 1
- 102100040245 Tumor necrosis factor receptor superfamily member 5 Human genes 0.000 description 1
- 102100036857 Tumor necrosis factor receptor superfamily member 8 Human genes 0.000 description 1
- JAQGKXUEKGKTKX-HOTGVXAUSA-N Tyr-Tyr Chemical compound C([C@H](N)C(=O)N[C@@H](CC=1C=CC(O)=CC=1)C(O)=O)C1=CC=C(O)C=C1 JAQGKXUEKGKTKX-HOTGVXAUSA-N 0.000 description 1
- 108091023045 Untranslated Region Proteins 0.000 description 1
- 229910052770 Uranium Inorganic materials 0.000 description 1
- 101150117115 V gene Proteins 0.000 description 1
- 240000001866 Vernicia fordii Species 0.000 description 1
- 208000018777 Vulvar intraepithelial neoplasia Diseases 0.000 description 1
- SVSFCSOFEPJFSF-OEPVMNMSSA-N [(2r,3s,5r,6s,7r,8e,11s,12z,14e)-20,22-dihydroxy-2,5,6-trimethoxy-3,7,9,11,15-pentamethyl-16-oxo-17-azabicyclo[16.3.1]docosa-1(21),8,12,14,18(22),19-hexaen-10-yl] carbamate Chemical compound N1C(=O)\C(C)=C\C=C/[C@H](C)C(OC(N)=O)\C(C)=C\[C@@H](C)[C@H](OC)[C@H](OC)C[C@H](C)[C@@H](OC)C2=CC(O)=CC1=C2O SVSFCSOFEPJFSF-OEPVMNMSSA-N 0.000 description 1
- SVSFCSOFEPJFSF-GGDLZHBGSA-N [(4e,6z,10e)-20,22-dihydroxy-13,14,17-trimethoxy-4,8,10,12,16-pentamethyl-3-oxo-2-azabicyclo[16.3.1]docosa-1(21),4,6,10,18(22),19-hexaen-9-yl] carbamate Chemical compound N1C(=O)\C(C)=C\C=C/C(C)C(OC(N)=O)\C(C)=C\C(C)C(OC)C(OC)CC(C)C(OC)C2=CC(O)=CC1=C2O SVSFCSOFEPJFSF-GGDLZHBGSA-N 0.000 description 1
- IEDXPSOJFSVCKU-HOKPPMCLSA-N [4-[[(2S)-5-(carbamoylamino)-2-[[(2S)-2-[6-(2,5-dioxopyrrolidin-1-yl)hexanoylamino]-3-methylbutanoyl]amino]pentanoyl]amino]phenyl]methyl N-[(2S)-1-[[(2S)-1-[[(3R,4S,5S)-1-[(2S)-2-[(1R,2R)-3-[[(1S,2R)-1-hydroxy-1-phenylpropan-2-yl]amino]-1-methoxy-2-methyl-3-oxopropyl]pyrrolidin-1-yl]-3-methoxy-5-methyl-1-oxoheptan-4-yl]-methylamino]-3-methyl-1-oxobutan-2-yl]amino]-3-methyl-1-oxobutan-2-yl]-N-methylcarbamate Chemical compound CC[C@H](C)[C@@H]([C@@H](CC(=O)N1CCC[C@H]1[C@H](OC)[C@@H](C)C(=O)N[C@H](C)[C@@H](O)c1ccccc1)OC)N(C)C(=O)[C@@H](NC(=O)[C@H](C(C)C)N(C)C(=O)OCc1ccc(NC(=O)[C@H](CCCNC(N)=O)NC(=O)[C@@H](NC(=O)CCCCCN2C(=O)CCC2=O)C(C)C)cc1)C(C)C IEDXPSOJFSVCKU-HOKPPMCLSA-N 0.000 description 1
- 230000005856 abnormality Effects 0.000 description 1
- 239000002253 acid Substances 0.000 description 1
- 230000002378 acidificating effect Effects 0.000 description 1
- 229950008427 acivicin Drugs 0.000 description 1
- 239000012190 activator Substances 0.000 description 1
- 229960000643 adenine Drugs 0.000 description 1
- 150000001298 alcohols Chemical class 0.000 description 1
- 150000001338 aliphatic hydrocarbons Chemical class 0.000 description 1
- 229940100198 alkylating agent Drugs 0.000 description 1
- 239000002168 alkylating agent Substances 0.000 description 1
- 238000007112 amidation reaction Methods 0.000 description 1
- 150000001412 amines Chemical class 0.000 description 1
- 150000001414 amino alcohols Chemical class 0.000 description 1
- 229960003896 aminopterin Drugs 0.000 description 1
- 229960004701 amonafide Drugs 0.000 description 1
- 238000004873 anchoring Methods 0.000 description 1
- 229950000242 ancitabine Drugs 0.000 description 1
- 230000000340 anti-metabolite Effects 0.000 description 1
- 239000000611 antibody drug conjugate Substances 0.000 description 1
- 210000000628 antibody-producing cell Anatomy 0.000 description 1
- 230000014102 antigen processing and presentation of exogenous peptide antigen via MHC class I Effects 0.000 description 1
- 230000000890 antigenic effect Effects 0.000 description 1
- 229940100197 antimetabolite Drugs 0.000 description 1
- 239000002256 antimetabolite Substances 0.000 description 1
- 239000003080 antimitotic agent Substances 0.000 description 1
- 210000000436 anus Anatomy 0.000 description 1
- 239000007864 aqueous solution Substances 0.000 description 1
- 206010003246 arthritis Diseases 0.000 description 1
- 239000000823 artificial membrane Substances 0.000 description 1
- 125000003118 aryl group Chemical group 0.000 description 1
- 125000000613 asparagine group Chemical group N[C@@H](CC(N)=O)C(=O)* 0.000 description 1
- 229960002756 azacitidine Drugs 0.000 description 1
- 230000001580 bacterial effect Effects 0.000 description 1
- 239000000688 bacterial toxin Substances 0.000 description 1
- WPYMKLBDIGXBTP-UHFFFAOYSA-N benzoic acid Chemical compound OC(=O)C1=CC=CC=C1 WPYMKLBDIGXBTP-UHFFFAOYSA-N 0.000 description 1
- 108010081355 beta 2-Microglobulin Proteins 0.000 description 1
- IQFYYKKMVGJFEH-UHFFFAOYSA-N beta-L-thymidine Natural products O=C1NC(=O)C(C)=CN1C1OC(CO)C(O)C1 IQFYYKKMVGJFEH-UHFFFAOYSA-N 0.000 description 1
- SQVRNKJHWKZAKO-UHFFFAOYSA-N beta-N-Acetyl-D-neuraminic acid Natural products CC(=O)NC1C(O)CC(O)(C(O)=O)OC1C(O)C(O)CO SQVRNKJHWKZAKO-UHFFFAOYSA-N 0.000 description 1
- 102000006635 beta-lactamase Human genes 0.000 description 1
- 238000013357 binding ELISA Methods 0.000 description 1
- 230000003115 biocidal effect Effects 0.000 description 1
- 238000010170 biological method Methods 0.000 description 1
- 239000000090 biomarker Substances 0.000 description 1
- 210000000601 blood cell Anatomy 0.000 description 1
- 210000001772 blood platelet Anatomy 0.000 description 1
- 229950010231 brequinar Drugs 0.000 description 1
- 108010049223 bryodin Proteins 0.000 description 1
- 229960005520 bryostatin Drugs 0.000 description 1
- MJQUEDHRCUIRLF-TVIXENOKSA-N bryostatin 1 Chemical compound C([C@@H]1CC(/[C@@H]([C@@](C(C)(C)/C=C/2)(O)O1)OC(=O)/C=C/C=C/CCC)=C\C(=O)OC)[C@H]([C@@H](C)O)OC(=O)C[C@H](O)C[C@@H](O1)C[C@H](OC(C)=O)C(C)(C)[C@]1(O)C[C@@H]1C\C(=C\C(=O)OC)C[C@H]\2O1 MJQUEDHRCUIRLF-TVIXENOKSA-N 0.000 description 1
- MUIWQCKLQMOUAT-AKUNNTHJSA-N bryostatin 20 Natural products COC(=O)C=C1C[C@@]2(C)C[C@]3(O)O[C@](C)(C[C@@H](O)CC(=O)O[C@](C)(C[C@@]4(C)O[C@](O)(CC5=CC(=O)O[C@]45C)C(C)(C)C=C[C@@](C)(C1)O2)[C@@H](C)O)C[C@H](OC(=O)C(C)(C)C)C3(C)C MUIWQCKLQMOUAT-AKUNNTHJSA-N 0.000 description 1
- 229960002092 busulfan Drugs 0.000 description 1
- ZTQSAGDEMFDKMZ-UHFFFAOYSA-N butyric aldehyde Natural products CCCC=O ZTQSAGDEMFDKMZ-UHFFFAOYSA-N 0.000 description 1
- 229910052791 calcium Inorganic materials 0.000 description 1
- 239000003710 calcium ionophore Substances 0.000 description 1
- 230000005880 cancer cell killing Effects 0.000 description 1
- 230000005773 cancer-related death Effects 0.000 description 1
- 239000002041 carbon nanotube Substances 0.000 description 1
- 229910021393 carbon nanotube Inorganic materials 0.000 description 1
- 239000001768 carboxy methyl cellulose Substances 0.000 description 1
- 235000010948 carboxy methyl cellulose Nutrition 0.000 description 1
- 239000008112 carboxymethyl-cellulose Substances 0.000 description 1
- 230000015556 catabolic process Effects 0.000 description 1
- 150000001768 cations Chemical class 0.000 description 1
- 230000020411 cell activation Effects 0.000 description 1
- 238000000423 cell based assay Methods 0.000 description 1
- 230000030833 cell death Effects 0.000 description 1
- 230000003915 cell function Effects 0.000 description 1
- 230000022534 cell killing Effects 0.000 description 1
- 210000000170 cell membrane Anatomy 0.000 description 1
- 230000004663 cell proliferation Effects 0.000 description 1
- 238000005119 centrifugation Methods 0.000 description 1
- 201000006612 cervical squamous cell carcinoma Diseases 0.000 description 1
- 238000006243 chemical reaction Methods 0.000 description 1
- 229960004630 chlorambucil Drugs 0.000 description 1
- 229960001480 chlorozotocin Drugs 0.000 description 1
- 210000000349 chromosome Anatomy 0.000 description 1
- DQLATGHUWYMOKM-UHFFFAOYSA-L cisplatin Chemical compound N[Pt](N)(Cl)Cl DQLATGHUWYMOKM-UHFFFAOYSA-L 0.000 description 1
- 229960004316 cisplatin Drugs 0.000 description 1
- 238000003776 cleavage reaction Methods 0.000 description 1
- 230000004186 co-expression Effects 0.000 description 1
- 238000012761 co-transfection Methods 0.000 description 1
- 238000001246 colloidal dispersion Methods 0.000 description 1
- 239000000084 colloidal system Substances 0.000 description 1
- 230000009137 competitive binding Effects 0.000 description 1
- 239000002299 complementary DNA Substances 0.000 description 1
- 239000003184 complementary RNA Substances 0.000 description 1
- 238000004590 computer program Methods 0.000 description 1
- 230000003750 conditioning effect Effects 0.000 description 1
- 239000000470 constituent Substances 0.000 description 1
- 239000007822 coupling agent Substances 0.000 description 1
- 230000009260 cross reactivity Effects 0.000 description 1
- 239000013078 crystal Substances 0.000 description 1
- 230000016396 cytokine production Effects 0.000 description 1
- 230000002380 cytological effect Effects 0.000 description 1
- 210000000805 cytoplasm Anatomy 0.000 description 1
- 238000006731 degradation reaction Methods 0.000 description 1
- 230000003413 degradative effect Effects 0.000 description 1
- 230000000779 depleting effect Effects 0.000 description 1
- 238000001514 detection method Methods 0.000 description 1
- 238000011161 development Methods 0.000 description 1
- 230000018109 developmental process Effects 0.000 description 1
- 238000000502 dialysis Methods 0.000 description 1
- 229950000758 dianhydrogalactitol Drugs 0.000 description 1
- 229930191339 dianthin Natural products 0.000 description 1
- 235000014113 dietary fatty acids Nutrition 0.000 description 1
- 230000029087 digestion Effects 0.000 description 1
- 125000005442 diisocyanate group Chemical group 0.000 description 1
- 238000010790 dilution Methods 0.000 description 1
- 239000012895 dilution Substances 0.000 description 1
- 238000006471 dimerization reaction Methods 0.000 description 1
- 230000003467 diminishing effect Effects 0.000 description 1
- FSXRLASFHBWESK-UHFFFAOYSA-N dipeptide phenylalanyl-tyrosine Natural products C=1C=C(O)C=CC=1CC(C(O)=O)NC(=O)C(N)CC1=CC=CC=C1 FSXRLASFHBWESK-UHFFFAOYSA-N 0.000 description 1
- 206010013023 diphtheria Diseases 0.000 description 1
- 230000008034 disappearance Effects 0.000 description 1
- 230000005750 disease progression Effects 0.000 description 1
- 238000010494 dissociation reaction Methods 0.000 description 1
- 230000005593 dissociations Effects 0.000 description 1
- 238000009826 distribution Methods 0.000 description 1
- ZWIBGKZDAWNIFC-UHFFFAOYSA-N disuccinimidyl suberate Chemical compound O=C1CCC(=O)N1OC(=O)CCCCCCC(=O)ON1C(=O)CCC1=O ZWIBGKZDAWNIFC-UHFFFAOYSA-N 0.000 description 1
- 229930188854 dolastatin Natural products 0.000 description 1
- OFDNQWIFNXBECV-VFSYNPLYSA-N dolastatin 10 Chemical compound CC(C)[C@H](N(C)C)C(=O)N[C@@H](C(C)C)C(=O)N(C)[C@@H]([C@@H](C)CC)[C@H](OC)CC(=O)N1CCC[C@H]1[C@H](OC)[C@@H](C)C(=O)N[C@H](C=1SC=CN=1)CC1=CC=CC=C1 OFDNQWIFNXBECV-VFSYNPLYSA-N 0.000 description 1
- 230000003828 downregulation Effects 0.000 description 1
- 238000009509 drug development Methods 0.000 description 1
- 229960005501 duocarmycin Drugs 0.000 description 1
- VQNATVDKACXKTF-XELLLNAOSA-N duocarmycin Chemical compound COC1=C(OC)C(OC)=C2NC(C(=O)N3C4=CC(=O)C5=C([C@@]64C[C@@H]6C3)C=C(N5)C(=O)OC)=CC2=C1 VQNATVDKACXKTF-XELLLNAOSA-N 0.000 description 1
- 229930184221 duocarmycin Natural products 0.000 description 1
- 238000004520 electroporation Methods 0.000 description 1
- 238000010828 elution Methods 0.000 description 1
- 239000000839 emulsion Substances 0.000 description 1
- 239000003623 enhancer Substances 0.000 description 1
- 230000002708 enhancing effect Effects 0.000 description 1
- 108010028531 enomycin Proteins 0.000 description 1
- 210000002919 epithelial cell Anatomy 0.000 description 1
- ITSGNOIFAJAQHJ-BMFNZSJVSA-N esorubicin Chemical compound O([C@H]1C[C@@](O)(CC=2C(O)=C3C(=O)C=4C=CC=C(C=4C(=O)C3=C(O)C=21)OC)C(=O)CO)[C@H]1C[C@H](N)C[C@H](C)O1 ITSGNOIFAJAQHJ-BMFNZSJVSA-N 0.000 description 1
- LJQQFQHBKUKHIS-WJHRIEJJSA-N esperamicin Chemical compound O1CC(NC(C)C)C(OC)CC1OC1C(O)C(NOC2OC(C)C(SC)C(O)C2)C(C)OC1OC1C(\C2=C/CSSSC)=C(NC(=O)OC)C(=O)C(OC3OC(C)C(O)C(OC(=O)C=4C(=CC(OC)=C(OC)C=4)NC(=O)C(=C)OC)C3)C2(O)C#C\C=C/C#C1 LJQQFQHBKUKHIS-WJHRIEJJSA-N 0.000 description 1
- 150000002148 esters Chemical class 0.000 description 1
- GBPZYMBDOBODNK-SFTDATJTSA-N ethyl (2s)-2-[[(2s)-2-acetamido-3-[4-[bis(2-chloroethyl)amino]phenyl]propanoyl]amino]-4-methylpentanoate Chemical compound CCOC(=O)[C@H](CC(C)C)NC(=O)[C@@H](NC(C)=O)CC1=CC=C(N(CCCl)CCCl)C=C1 GBPZYMBDOBODNK-SFTDATJTSA-N 0.000 description 1
- GBPZYMBDOBODNK-LBAQZLPGSA-N ethyl (2s)-2-[[2-acetamido-3-[4-[bis(2-chloroethyl)amino]phenyl]propanoyl]amino]-4-methylpentanoate Chemical compound CCOC(=O)[C@H](CC(C)C)NC(=O)C(NC(C)=O)CC1=CC=C(N(CCCl)CCCl)C=C1 GBPZYMBDOBODNK-LBAQZLPGSA-N 0.000 description 1
- CJAONIOAQZUHPN-KKLWWLSJSA-N ethyl 12-[[2-[(2r,3r)-3-[2-[(12-ethoxy-12-oxododecyl)-methylamino]-2-oxoethoxy]butan-2-yl]oxyacetyl]-methylamino]dodecanoate Chemical compound CCOC(=O)CCCCCCCCCCCN(C)C(=O)CO[C@H](C)[C@@H](C)OCC(=O)N(C)CCCCCCCCCCCC(=O)OCC CJAONIOAQZUHPN-KKLWWLSJSA-N 0.000 description 1
- 229960005420 etoposide Drugs 0.000 description 1
- 229930195729 fatty acid Natural products 0.000 description 1
- 239000000194 fatty acid Substances 0.000 description 1
- 150000004665 fatty acids Chemical class 0.000 description 1
- 210000004700 fetal blood Anatomy 0.000 description 1
- 210000003754 fetus Anatomy 0.000 description 1
- XRECTZIEBJDKEO-UHFFFAOYSA-N flucytosine Chemical compound NC1=NC(=O)NC=C1F XRECTZIEBJDKEO-UHFFFAOYSA-N 0.000 description 1
- 229960004413 flucytosine Drugs 0.000 description 1
- 239000012530 fluid Substances 0.000 description 1
- MHMNJMPURVTYEJ-UHFFFAOYSA-N fluorescein-5-isothiocyanate Chemical compound O1C(=O)C2=CC(N=C=S)=CC=C2C21C1=CC=C(O)C=C1OC1=CC(O)=CC=C21 MHMNJMPURVTYEJ-UHFFFAOYSA-N 0.000 description 1
- 150000002222 fluorine compounds Chemical class 0.000 description 1
- 101150023212 fut8 gene Proteins 0.000 description 1
- UIWYJDYFSGRHKR-UHFFFAOYSA-N gadolinium atom Chemical compound [Gd] UIWYJDYFSGRHKR-UHFFFAOYSA-N 0.000 description 1
- 229930182830 galactose Natural products 0.000 description 1
- 238000001502 gel electrophoresis Methods 0.000 description 1
- QTQAWLPCGQOSGP-GBTDJJJQSA-N geldanamycin Chemical compound N1C(=O)\C(C)=C/C=C\[C@@H](OC)[C@H](OC(N)=O)\C(C)=C/[C@@H](C)[C@@H](O)[C@H](OC)C[C@@H](C)CC2=C(OC)C(=O)C=C1C2=O QTQAWLPCGQOSGP-GBTDJJJQSA-N 0.000 description 1
- 238000003500 gene array Methods 0.000 description 1
- 230000002068 genetic effect Effects 0.000 description 1
- 239000003862 glucocorticoid Substances 0.000 description 1
- 239000008187 granular material Substances 0.000 description 1
- 210000003714 granulocyte Anatomy 0.000 description 1
- 230000003394 haemopoietic effect Effects 0.000 description 1
- FXNFULJVOQMBCW-VZBLNRDYSA-N halichondrin b Chemical compound O([C@@H]1[C@@H](C)[C@@H]2O[C@@H]3C[C@@]4(O[C@H]5[C@@H](C)C[C@@]6(C[C@@H]([C@@H]7O[C@@H](C[C@@H]7O6)[C@@H](O)C[C@@H](O)CO)C)O[C@H]5C4)O[C@@H]3C[C@@H]2O[C@H]1C[C@@H]1C(=C)[C@H](C)C[C@@H](O1)CC[C@H]1C(=C)C[C@@H](O1)CC1)C(=O)C[C@H](O2)CC[C@H]3[C@H]2[C@H](O2)[C@@H]4O[C@@H]5C[C@@]21O[C@@H]5[C@@H]4O3 FXNFULJVOQMBCW-VZBLNRDYSA-N 0.000 description 1
- 230000036541 health Effects 0.000 description 1
- 210000002443 helper t lymphocyte Anatomy 0.000 description 1
- 210000003494 hepatocyte Anatomy 0.000 description 1
- 239000000833 heterodimer Substances 0.000 description 1
- 102000046004 human WT1 Human genes 0.000 description 1
- 210000005260 human cell Anatomy 0.000 description 1
- 208000033519 human immunodeficiency virus infectious disease Diseases 0.000 description 1
- 238000009396 hybridization Methods 0.000 description 1
- 229950000216 hycanthone Drugs 0.000 description 1
- 229910052739 hydrogen Inorganic materials 0.000 description 1
- 239000001257 hydrogen Substances 0.000 description 1
- 230000002209 hydrophobic effect Effects 0.000 description 1
- 125000001165 hydrophobic group Chemical group 0.000 description 1
- WGCNASOHLSPBMP-UHFFFAOYSA-N hydroxyacetaldehyde Natural products OCC=O WGCNASOHLSPBMP-UHFFFAOYSA-N 0.000 description 1
- 229960001330 hydroxycarbamide Drugs 0.000 description 1
- 238000012872 hydroxylapatite chromatography Methods 0.000 description 1
- CSFWPUWCSPOLJW-UHFFFAOYSA-N hydroxynaphthoquinone Natural products C1=CC=C2C(=O)C(O)=CC(=O)C2=C1 CSFWPUWCSPOLJW-UHFFFAOYSA-N 0.000 description 1
- 239000012216 imaging agent Substances 0.000 description 1
- 238000003384 imaging method Methods 0.000 description 1
- 150000002463 imidates Chemical class 0.000 description 1
- 230000007124 immune defense Effects 0.000 description 1
- 230000002163 immunogen Effects 0.000 description 1
- 238000001114 immunoprecipitation Methods 0.000 description 1
- 238000012744 immunostaining Methods 0.000 description 1
- 238000009169 immunotherapy Methods 0.000 description 1
- 238000000099 in vitro assay Methods 0.000 description 1
- 239000005414 inactive ingredient Substances 0.000 description 1
- 230000008595 infiltration Effects 0.000 description 1
- 238000001764 infiltration Methods 0.000 description 1
- 108091008042 inhibitory receptors Proteins 0.000 description 1
- 229960003786 inosine Drugs 0.000 description 1
- 230000002452 interceptive effect Effects 0.000 description 1
- 230000007154 intracellular accumulation Effects 0.000 description 1
- 229910052742 iron Inorganic materials 0.000 description 1
- 238000011031 large-scale manufacturing process Methods 0.000 description 1
- 229910052745 lead Inorganic materials 0.000 description 1
- 208000032839 leukemia Diseases 0.000 description 1
- 230000000670 limiting effect Effects 0.000 description 1
- 238000001638 lipofection Methods 0.000 description 1
- 230000004807 localization Effects 0.000 description 1
- 125000003588 lysine group Chemical group [H]N([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])(N([H])[H])C(*)=O 0.000 description 1
- 230000002934 lysing effect Effects 0.000 description 1
- 229920002521 macromolecule Polymers 0.000 description 1
- 229910052749 magnesium Inorganic materials 0.000 description 1
- FVVLHONNBARESJ-NTOWJWGLSA-H magnesium;potassium;trisodium;(2r,3s,4r,5r)-2,3,4,5,6-pentahydroxyhexanoate;acetate;tetrachloride;nonahydrate Chemical compound O.O.O.O.O.O.O.O.O.[Na+].[Na+].[Na+].[Mg+2].[Cl-].[Cl-].[Cl-].[Cl-].[K+].CC([O-])=O.OC[C@@H](O)[C@@H](O)[C@H](O)[C@@H](O)C([O-])=O FVVLHONNBARESJ-NTOWJWGLSA-H 0.000 description 1
- 238000012423 maintenance Methods 0.000 description 1
- 229910052748 manganese Inorganic materials 0.000 description 1
- 239000011572 manganese Substances 0.000 description 1
- 230000008774 maternal effect Effects 0.000 description 1
- 238000001840 matrix-assisted laser desorption--ionisation time-of-flight mass spectrometry Methods 0.000 description 1
- 230000007246 mechanism Effects 0.000 description 1
- 230000010534 mechanism of action Effects 0.000 description 1
- 229960004961 mechlorethamine Drugs 0.000 description 1
- HAWPXGHAZFHHAD-UHFFFAOYSA-N mechlorethamine Chemical class ClCCN(C)CCCl HAWPXGHAZFHHAD-UHFFFAOYSA-N 0.000 description 1
- 238000002483 medication Methods 0.000 description 1
- 229960001924 melphalan Drugs 0.000 description 1
- SGDBTWWWUNNDEQ-LBPRGKRZSA-N melphalan Chemical compound OC(=O)[C@@H](N)CC1=CC=C(N(CCCl)CCCl)C=C1 SGDBTWWWUNNDEQ-LBPRGKRZSA-N 0.000 description 1
- 239000012528 membrane Substances 0.000 description 1
- 229950002676 menogaril Drugs 0.000 description 1
- GLVAUDGFNGKCSF-UHFFFAOYSA-N mercaptopurine Chemical compound S=C1NC=NC2=C1NC=N2 GLVAUDGFNGKCSF-UHFFFAOYSA-N 0.000 description 1
- 238000010197 meta-analysis Methods 0.000 description 1
- 229910052751 metal Inorganic materials 0.000 description 1
- 239000002184 metal Substances 0.000 description 1
- 229910021645 metal ion Inorganic materials 0.000 description 1
- 208000037819 metastatic cancer Diseases 0.000 description 1
- 208000011575 metastatic malignant neoplasm Diseases 0.000 description 1
- NMKUAEKKJQYLHK-KRWDZBQOSA-N methyl (7s)-7-acetamido-1,2,3-trimethoxy-6,7-dihydro-5h-dibenzo[5,3-b:1',2'-e][7]annulene-9-carboxylate Chemical compound CC(=O)N[C@H]1CCC2=CC(OC)=C(OC)C(OC)=C2C2=CC=C(C(=O)OC)C=C21 NMKUAEKKJQYLHK-KRWDZBQOSA-N 0.000 description 1
- DFTAZNAEBRBBKP-UHFFFAOYSA-N methyl 4-sulfanylbutanimidate Chemical compound COC(=N)CCCS DFTAZNAEBRBBKP-UHFFFAOYSA-N 0.000 description 1
- 238000000520 microinjection Methods 0.000 description 1
- 238000000386 microscopy Methods 0.000 description 1
- 239000004005 microsphere Substances 0.000 description 1
- 231100000324 minimal toxicity Toxicity 0.000 description 1
- KKZJGLLVHKMTCM-UHFFFAOYSA-N mitoxantrone Chemical compound O=C1C2=C(O)C=CC(O)=C2C(=O)C2=C1C(NCCNCCO)=CC=C2NCCNCCO KKZJGLLVHKMTCM-UHFFFAOYSA-N 0.000 description 1
- 229960001156 mitoxantrone Drugs 0.000 description 1
- ZAHQPTJLOCWVPG-UHFFFAOYSA-N mitoxantrone dihydrochloride Chemical compound Cl.Cl.O=C1C2=C(O)C=CC(O)=C2C(=O)C2=C1C(NCCNCCO)=CC=C2NCCNCCO ZAHQPTJLOCWVPG-UHFFFAOYSA-N 0.000 description 1
- 238000002156 mixing Methods 0.000 description 1
- 108010010621 modeccin Proteins 0.000 description 1
- XTSSXTWGEJTWBM-FQEVSTJZSA-N n-[(7s)-1,2,3,10-tetramethoxy-9-oxo-6,7-dihydro-5h-benzo[a]heptalen-7-yl]benzamide Chemical compound N([C@H]1CCC=2C=C(C(=C(OC)C=2C2=CC=C(OC)C(=O)C=C21)OC)OC)C(=O)C1=CC=CC=C1 XTSSXTWGEJTWBM-FQEVSTJZSA-N 0.000 description 1
- CMEGANPVAXDBPL-INIZCTEOSA-N n-[(7s)-1,2,3-trimethoxy-10-methylsulfanyl-9-oxo-6,7-dihydro-5h-benzo[a]heptalen-7-yl]acetamide Chemical compound C1([C@@H](NC(C)=O)CC2)=CC(=O)C(SC)=CC=C1C1=C2C=C(OC)C(OC)=C1OC CMEGANPVAXDBPL-INIZCTEOSA-N 0.000 description 1
- KINULKKPVJYRON-PVNXHVEDSA-N n-[(e)-[10-[(e)-(4,5-dihydro-1h-imidazol-2-ylhydrazinylidene)methyl]anthracen-9-yl]methylideneamino]-4,5-dihydro-1h-imidazol-2-amine;hydron;dichloride Chemical compound Cl.Cl.N1CCN=C1N\N=C\C(C1=CC=CC=C11)=C(C=CC=C2)C2=C1\C=N\NC1=NCCN1 KINULKKPVJYRON-PVNXHVEDSA-N 0.000 description 1
- HBSXKBIYGYFNRF-JMLRMIEWSA-N n-[(z)-[10-[(z)-(4,5-dihydro-1h-imidazol-2-ylhydrazinylidene)methyl]anthracen-9-yl]methylideneamino]-4,5-dihydro-1h-imidazol-2-amine;hydrochloride Chemical compound Cl.N1CCN=C1N\N=C/C(C1=CC=CC=C11)=C(C=CC=C2)C2=C1\C=N/NC1=NCCN1 HBSXKBIYGYFNRF-JMLRMIEWSA-N 0.000 description 1
- NKFHKYQGZDAKMX-QMFNWPJUSA-N n-[1-[(2s,4s)-4-[(2r,4s,5s,6s)-4-amino-5-hydroxy-6-methyloxan-2-yl]oxy-2,5,12-trihydroxy-7-methoxy-6,11-dioxo-3,4-dihydro-1h-tetracen-2-yl]ethylideneamino]benzamide;hydrochloride Chemical compound Cl.O([C@H]1C[C@@](O)(CC=2C(O)=C3C(=O)C=4C=CC=C(C=4C(=O)C3=C(O)C=21)OC)C(C)=NNC(=O)C=1C=CC=CC=1)[C@H]1C[C@H](N)[C@H](O)[C@H](C)O1 NKFHKYQGZDAKMX-QMFNWPJUSA-N 0.000 description 1
- 229950006780 n-acetylglucosamine Drugs 0.000 description 1
- 239000002088 nanocapsule Substances 0.000 description 1
- 210000000581 natural killer T-cell Anatomy 0.000 description 1
- 229910052757 nitrogen Inorganic materials 0.000 description 1
- 231100000252 nontoxic Toxicity 0.000 description 1
- 230000001293 nucleolytic effect Effects 0.000 description 1
- 239000002751 oligonucleotide probe Substances 0.000 description 1
- 231100000590 oncogenic Toxicity 0.000 description 1
- 230000002246 oncogenic effect Effects 0.000 description 1
- 108091008819 oncoproteins Proteins 0.000 description 1
- 102000027450 oncoproteins Human genes 0.000 description 1
- 210000000056 organ Anatomy 0.000 description 1
- 210000003300 oropharynx Anatomy 0.000 description 1
- 210000001672 ovary Anatomy 0.000 description 1
- 210000002741 palatine tonsil Anatomy 0.000 description 1
- 208000003154 papilloma Diseases 0.000 description 1
- 230000036961 partial effect Effects 0.000 description 1
- 244000052769 pathogen Species 0.000 description 1
- 230000001717 pathogenic effect Effects 0.000 description 1
- 230000001575 pathological effect Effects 0.000 description 1
- NETARJWZTMGMRM-JRTPPQMASA-N peloruside A Chemical compound C1[C@H](OC)[C@@H](O)C(=O)O[C@@H](C(\C)=C/[C@@H](CO)CC)C[C@H](OC)C[C@@H](O)C(C)(C)[C@@]2(O)[C@@H](O)[C@@H](OC)C[C@@H]1O2 NETARJWZTMGMRM-JRTPPQMASA-N 0.000 description 1
- NETARJWZTMGMRM-KJHLVSCNSA-N peloruside A Natural products CC[C@@H](CO)C=C(C)[C@@H]1C[C@H](C[C@H](O)C(C)(C)[C@@]2(O)O[C@@H](C[C@@H](OC)[C@H](O)C(=O)O1)C[C@@H](OC)[C@H]2O)OC NETARJWZTMGMRM-KJHLVSCNSA-N 0.000 description 1
- 210000003899 penis Anatomy 0.000 description 1
- QIMGFXOHTOXMQP-GFAGFCTOSA-N peplomycin Chemical compound N([C@H](C(=O)N[C@H](C)[C@@H](O)[C@H](C)C(=O)N[C@@H]([C@H](O)C)C(=O)NCCC=1SC=C(N=1)C=1SC=C(N=1)C(=O)NCCCN[C@@H](C)C=1C=CC=CC=1)[C@@H](O[C@H]1[C@H]([C@@H](O)[C@H](O)[C@H](CO)O1)O[C@@H]1[C@H]([C@@H](OC(N)=O)[C@H](O)[C@@H](CO)O1)O)C=1NC=NC=1)C(=O)C1=NC([C@H](CC(N)=O)NC[C@H](N)C(N)=O)=NC(N)=C1C QIMGFXOHTOXMQP-GFAGFCTOSA-N 0.000 description 1
- 229950003180 peplomycin Drugs 0.000 description 1
- 125000001151 peptidyl group Chemical group 0.000 description 1
- 230000002093 peripheral effect Effects 0.000 description 1
- 230000002688 persistence Effects 0.000 description 1
- 108010076042 phenomycin Proteins 0.000 description 1
- COLNVLDHVKWLRT-UHFFFAOYSA-N phenylalanine Natural products OC(=O)C(N)CC1=CC=CC=C1 COLNVLDHVKWLRT-UHFFFAOYSA-N 0.000 description 1
- NBIIXXVUZAFLBC-UHFFFAOYSA-K phosphate Chemical compound [O-]P([O-])([O-])=O NBIIXXVUZAFLBC-UHFFFAOYSA-K 0.000 description 1
- 239000010452 phosphate Substances 0.000 description 1
- 238000000053 physical method Methods 0.000 description 1
- JTHRRMFZHSDGNJ-UHFFFAOYSA-N piperazine-2,3-dione Chemical compound O=C1NCCNC1=O JTHRRMFZHSDGNJ-UHFFFAOYSA-N 0.000 description 1
- 229960000952 pipobroman Drugs 0.000 description 1
- 239000003123 plant toxin Substances 0.000 description 1
- 239000013612 plasmid Substances 0.000 description 1
- 229910052697 platinum Inorganic materials 0.000 description 1
- BASFCYQUMIYNBI-UHFFFAOYSA-N platinum Substances [Pt] BASFCYQUMIYNBI-UHFFFAOYSA-N 0.000 description 1
- 229920000191 poly(N-vinyl pyrrolidone) Polymers 0.000 description 1
- 229920001308 poly(aminoacid) Polymers 0.000 description 1
- 229920001583 poly(oxyethylated polyols) Polymers 0.000 description 1
- 108010054442 polyalanine Proteins 0.000 description 1
- 229920000036 polyvinylpyrrolidone Polymers 0.000 description 1
- 239000001267 polyvinylpyrrolidone Substances 0.000 description 1
- 235000013855 polyvinylpyrrolidone Nutrition 0.000 description 1
- 229950004406 porfiromycin Drugs 0.000 description 1
- 238000001556 precipitation Methods 0.000 description 1
- 239000002243 precursor Substances 0.000 description 1
- 230000002265 prevention Effects 0.000 description 1
- 238000012545 processing Methods 0.000 description 1
- 229960003387 progesterone Drugs 0.000 description 1
- 239000000186 progesterone Substances 0.000 description 1
- 238000004393 prognosis Methods 0.000 description 1
- 230000002062 proliferating effect Effects 0.000 description 1
- 230000001737 promoting effect Effects 0.000 description 1
- 229940021993 prophylactic vaccine Drugs 0.000 description 1
- 108060006633 protein kinase Proteins 0.000 description 1
- 238000001243 protein synthesis Methods 0.000 description 1
- 230000005855 radiation Effects 0.000 description 1
- 238000007420 radioactive assay Methods 0.000 description 1
- 238000010814 radioimmunoprecipitation assay Methods 0.000 description 1
- 238000011363 radioimmunotherapy Methods 0.000 description 1
- 239000012217 radiopharmaceutical Substances 0.000 description 1
- 229940121896 radiopharmaceutical Drugs 0.000 description 1
- 230000002799 radiopharmaceutical effect Effects 0.000 description 1
- 229920005604 random copolymer Polymers 0.000 description 1
- 238000003259 recombinant expression Methods 0.000 description 1
- 238000011084 recovery Methods 0.000 description 1
- 230000008929 regeneration Effects 0.000 description 1
- 238000011069 regeneration method Methods 0.000 description 1
- 238000010405 reoxidation reaction Methods 0.000 description 1
- 230000004044 response Effects 0.000 description 1
- 108091008146 restriction endonucleases Proteins 0.000 description 1
- 230000000717 retained effect Effects 0.000 description 1
- 238000003757 reverse transcription PCR Methods 0.000 description 1
- PYWVYCXTNDRMGF-UHFFFAOYSA-N rhodamine B Chemical compound [Cl-].C=12C=CC(=[N+](CC)CC)C=C2OC2=CC(N(CC)CC)=CC=C2C=1C1=CC=CC=C1C(O)=O PYWVYCXTNDRMGF-UHFFFAOYSA-N 0.000 description 1
- 238000013391 scatchard analysis Methods 0.000 description 1
- 230000007017 scission Effects 0.000 description 1
- 230000028327 secretion Effects 0.000 description 1
- 231100000735 select agent Toxicity 0.000 description 1
- 238000010187 selection method Methods 0.000 description 1
- FVLVBPDQNARYJU-UHFFFAOYSA-N semustine Chemical compound CC1CCC(NC(=O)N(CCCl)N=O)CC1 FVLVBPDQNARYJU-UHFFFAOYSA-N 0.000 description 1
- SQVRNKJHWKZAKO-OQPLDHBCSA-N sialic acid Chemical compound CC(=O)N[C@@H]1[C@@H](O)C[C@@](O)(C(O)=O)OC1[C@H](O)[C@H](O)CO SQVRNKJHWKZAKO-OQPLDHBCSA-N 0.000 description 1
- 230000019491 signal transduction Effects 0.000 description 1
- 238000002741 site-directed mutagenesis Methods 0.000 description 1
- 239000011780 sodium chloride Substances 0.000 description 1
- 238000002415 sodium dodecyl sulfate polyacrylamide gel electrophoresis Methods 0.000 description 1
- RPACBEVZENYWOL-XFULWGLBSA-M sodium;(2r)-2-[6-(4-chlorophenoxy)hexyl]oxirane-2-carboxylate Chemical compound [Na+].C=1C=C(Cl)C=CC=1OCCCCCC[C@]1(C(=O)[O-])CO1 RPACBEVZENYWOL-XFULWGLBSA-M 0.000 description 1
- MKNJJMHQBYVHRS-UHFFFAOYSA-M sodium;1-[11-(2,5-dioxopyrrol-1-yl)undecanoyloxy]-2,5-dioxopyrrolidine-3-sulfonate Chemical compound [Na+].O=C1C(S(=O)(=O)[O-])CC(=O)N1OC(=O)CCCCCCCCCCN1C(=O)C=CC1=O MKNJJMHQBYVHRS-UHFFFAOYSA-M 0.000 description 1
- VUFNRPJNRFOTGK-UHFFFAOYSA-M sodium;1-[4-[(2,5-dioxopyrrol-1-yl)methyl]cyclohexanecarbonyl]oxy-2,5-dioxopyrrolidine-3-sulfonate Chemical compound [Na+].O=C1C(S(=O)(=O)[O-])CC(=O)N1OC(=O)C1CCC(CN2C(C=CC2=O)=O)CC1 VUFNRPJNRFOTGK-UHFFFAOYSA-M 0.000 description 1
- MIDXXTLMKGZDPV-UHFFFAOYSA-M sodium;1-[6-(2,5-dioxopyrrol-1-yl)hexanoyloxy]-2,5-dioxopyrrolidine-3-sulfonate Chemical compound [Na+].O=C1C(S(=O)(=O)[O-])CC(=O)N1OC(=O)CCCCCN1C(=O)C=CC1=O MIDXXTLMKGZDPV-UHFFFAOYSA-M 0.000 description 1
- 239000007790 solid phase Substances 0.000 description 1
- 230000000392 somatic effect Effects 0.000 description 1
- 210000004989 spleen cell Anatomy 0.000 description 1
- 230000006641 stabilisation Effects 0.000 description 1
- 238000011105 stabilization Methods 0.000 description 1
- 230000000087 stabilizing effect Effects 0.000 description 1
- 229950009902 stallimycin Drugs 0.000 description 1
- 108010042747 stallimycin Proteins 0.000 description 1
- 238000010561 standard procedure Methods 0.000 description 1
- 210000000130 stem cell Anatomy 0.000 description 1
- 239000000758 substrate Substances 0.000 description 1
- 235000000346 sugar Nutrition 0.000 description 1
- 108060007951 sulfatase Proteins 0.000 description 1
- 239000000725 suspension Substances 0.000 description 1
- 230000002459 sustained effect Effects 0.000 description 1
- 238000007910 systemic administration Methods 0.000 description 1
- 150000004579 taxol derivatives Chemical class 0.000 description 1
- 229960001674 tegafur Drugs 0.000 description 1
- WFWLQNSHRPWKFK-ZCFIWIBFSA-N tegafur Chemical compound O=C1NC(=O)C(F)=CN1[C@@H]1OCCC1 WFWLQNSHRPWKFK-ZCFIWIBFSA-N 0.000 description 1
- 229950008703 teroxirone Drugs 0.000 description 1
- 229930101283 tetracycline Natural products 0.000 description 1
- 229960002180 tetracycline Drugs 0.000 description 1
- 235000019364 tetracycline Nutrition 0.000 description 1
- 150000003522 tetracyclines Chemical class 0.000 description 1
- 125000003396 thiol group Chemical group [H]S* 0.000 description 1
- CNHYKKNIIGEXAY-UHFFFAOYSA-N thiolan-2-imine Chemical compound N=C1CCCS1 CNHYKKNIIGEXAY-UHFFFAOYSA-N 0.000 description 1
- 229960001196 thiotepa Drugs 0.000 description 1
- 229940104230 thymidine Drugs 0.000 description 1
- 210000001541 thymus gland Anatomy 0.000 description 1
- RUELTTOHQODFPA-UHFFFAOYSA-N toluene 2,6-diisocyanate Chemical compound CC1=C(N=C=O)C=CC=C1N=C=O RUELTTOHQODFPA-UHFFFAOYSA-N 0.000 description 1
- 230000001988 toxicity Effects 0.000 description 1
- 231100000419 toxicity Toxicity 0.000 description 1
- 230000002110 toxicologic effect Effects 0.000 description 1
- 231100000027 toxicology Toxicity 0.000 description 1
- 230000007888 toxin activity Effects 0.000 description 1
- 229940043263 traditional drug Drugs 0.000 description 1
- 230000002103 transcriptional effect Effects 0.000 description 1
- 230000002463 transducing effect Effects 0.000 description 1
- 238000010361 transduction Methods 0.000 description 1
- 230000026683 transduction Effects 0.000 description 1
- 230000009466 transformation Effects 0.000 description 1
- 238000013519 translation Methods 0.000 description 1
- 108091005703 transmembrane proteins Proteins 0.000 description 1
- 102000035160 transmembrane proteins Human genes 0.000 description 1
- 229950001353 tretamine Drugs 0.000 description 1
- LZAJKCZTKKKZNT-PMNGPLLRSA-N trichothecene Chemical compound C12([C@@]3(CC[C@H]2OC2C=C(CCC23C)C)C)CO1 LZAJKCZTKKKZNT-PMNGPLLRSA-N 0.000 description 1
- 229930013292 trichothecene Natural products 0.000 description 1
- NOYPYLRCIDNJJB-UHFFFAOYSA-N trimetrexate Chemical compound COC1=C(OC)C(OC)=CC(NCC=2C(=C3C(N)=NC(N)=NC3=CC=2)C)=C1 NOYPYLRCIDNJJB-UHFFFAOYSA-N 0.000 description 1
- 229960001099 trimetrexate Drugs 0.000 description 1
- 230000004614 tumor growth Effects 0.000 description 1
- 108010003137 tyrosyltyrosine Proteins 0.000 description 1
- 238000000108 ultra-filtration Methods 0.000 description 1
- 241001529453 unidentified herpesvirus Species 0.000 description 1
- 229960001055 uracil mustard Drugs 0.000 description 1
- 238000002255 vaccination Methods 0.000 description 1
- 229960005486 vaccine Drugs 0.000 description 1
- 210000001215 vagina Anatomy 0.000 description 1
- 229960003048 vinblastine Drugs 0.000 description 1
- KDQAABAKXDWYSZ-PNYVAJAMSA-N vinblastine sulfate Chemical compound OS(O)(=O)=O.C([C@H](C[C@]1(C(=O)OC)C=2C(=CC3=C([C@]45[C@H]([C@@]([C@H](OC(C)=O)[C@]6(CC)C=CCN([C@H]56)CC4)(O)C(=O)OC)N3C)C=2)OC)C[C@@](C2)(O)CC)N2CCC2=C1NC1=CC=CC=C21 KDQAABAKXDWYSZ-PNYVAJAMSA-N 0.000 description 1
- 229960004982 vinblastine sulfate Drugs 0.000 description 1
- JXLYSJRDGCGARV-XQKSVPLYSA-N vincaleukoblastine Chemical compound C([C@@H](C[C@]1(C(=O)OC)C=2C(=CC3=C([C@]45[C@H]([C@@]([C@H](OC(C)=O)[C@]6(CC)C=CCN([C@H]56)CC4)(O)C(=O)OC)N3C)C=2)OC)C[C@@](C2)(O)CC)N2CCC2=C1NC1=CC=CC=C21 JXLYSJRDGCGARV-XQKSVPLYSA-N 0.000 description 1
- KDQAABAKXDWYSZ-JKDPCDLQSA-N vincaleukoblastine sulfate Chemical compound OS(O)(=O)=O.C([N@]1C[C@@H](C[C@]2(C(=O)OC)C=3C(=CC4=C([C@]56[C@H]([C@@]([C@H](OC(C)=O)[C@]7(CC)C=CCN([C@H]67)CC5)(O)C(=O)OC)N4C)C=3)OC)C[C@@](C1)(O)CC)CC1=C2NC2=CC=CC=C12 KDQAABAKXDWYSZ-JKDPCDLQSA-N 0.000 description 1
- OGWKCGZFUXNPDA-XQKSVPLYSA-N vincristine Chemical compound C([N@]1C[C@@H](C[C@]2(C(=O)OC)C=3C(=CC4=C([C@]56[C@H]([C@@]([C@H](OC(C)=O)[C@]7(CC)C=CCN([C@H]67)CC5)(O)C(=O)OC)N4C=O)C=3)OC)C[C@@](C1)(O)CC)CC1=C2NC2=CC=CC=C12 OGWKCGZFUXNPDA-XQKSVPLYSA-N 0.000 description 1
- 229960004528 vincristine Drugs 0.000 description 1
- OGWKCGZFUXNPDA-UHFFFAOYSA-N vincristine Natural products C1C(CC)(O)CC(CC2(C(=O)OC)C=3C(=CC4=C(C56C(C(C(OC(C)=O)C7(CC)C=CCN(C67)CC5)(O)C(=O)OC)N4C=O)C=3)OC)CN1CCC1=C2NC2=CC=CC=C12 OGWKCGZFUXNPDA-UHFFFAOYSA-N 0.000 description 1
- 229960002110 vincristine sulfate Drugs 0.000 description 1
- UGGWPQSBPIFKDZ-KOTLKJBCSA-N vindesine Chemical compound C([C@@H](C[C@]1(C(=O)OC)C=2C(=CC3=C([C@]45[C@H]([C@@]([C@H](O)[C@]6(CC)C=CCN([C@H]56)CC4)(O)C(N)=O)N3C)C=2)OC)C[C@@](C2)(O)CC)N2CCC2=C1N=C1[C]2C=CC=C1 UGGWPQSBPIFKDZ-KOTLKJBCSA-N 0.000 description 1
- 229960004355 vindesine Drugs 0.000 description 1
- 210000003905 vulva Anatomy 0.000 description 1
- XLYOFNOQVPJJNP-OUBTZVSYSA-N water-17o Chemical compound [17OH2] XLYOFNOQVPJJNP-OUBTZVSYSA-N 0.000 description 1
- 230000004584 weight gain Effects 0.000 description 1
- 235000019786 weight gain Nutrition 0.000 description 1
- 238000001262 western blot Methods 0.000 description 1
- FBTUMDXHSRTGRV-ALTNURHMSA-N zorubicin Chemical compound O([C@H]1C[C@@](O)(CC=2C(O)=C3C(=O)C=4C=CC=C(C=4C(=O)C3=C(O)C=21)OC)C(\C)=N\NC(=O)C=1C=CC=CC=1)[C@H]1C[C@H](N)[C@H](O)[C@H](C)O1 FBTUMDXHSRTGRV-ALTNURHMSA-N 0.000 description 1
- 229960000641 zorubicin Drugs 0.000 description 1
- 150000003952 β-lactams Chemical class 0.000 description 1
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
- C07K16/08—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from viruses
- C07K16/081—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from viruses from DNA viruses
- C07K16/084—Papovaviridae, e.g. papillomavirus, polyomavirus, SV40, BK virus, JC virus
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
- A61K38/04—Peptides having up to 20 amino acids in a fully defined sequence; Derivatives thereof
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/395—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum
- A61K39/42—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum viral
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/46—Cellular immunotherapy
- A61K39/461—Cellular immunotherapy characterised by the cell type used
- A61K39/4611—T-cells, e.g. tumor infiltrating lymphocytes [TIL], lymphokine-activated killer cells [LAK] or regulatory T cells [Treg]
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/46—Cellular immunotherapy
- A61K39/463—Cellular immunotherapy characterised by recombinant expression
- A61K39/4631—Chimeric Antigen Receptors [CAR]
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/46—Cellular immunotherapy
- A61K39/464—Cellular immunotherapy characterised by the antigen targeted or presented
- A61K39/464838—Viral antigens
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P43/00—Drugs for specific purposes, not provided for in groups A61P1/00-A61P41/00
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/2803—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily
- C07K16/2833—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily against MHC-molecules, e.g. HLA-molecules
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K2239/00—Indexing codes associated with cellular immunotherapy of group A61K39/46
- A61K2239/38—Indexing codes associated with cellular immunotherapy of group A61K39/46 characterised by the dose, timing or administration schedule
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K2239/00—Indexing codes associated with cellular immunotherapy of group A61K39/46
- A61K2239/46—Indexing codes associated with cellular immunotherapy of group A61K39/46 characterised by the cancer treated
- A61K2239/59—Reproductive system, e.g. uterus, ovaries, cervix or testes
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/705—Receptors; Cell surface antigens; Cell surface determinants
- C07K14/70503—Immunoglobulin superfamily
- C07K14/7051—T-cell receptor (TcR)-CD3 complex
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/20—Immunoglobulins specific features characterized by taxonomic origin
- C07K2317/21—Immunoglobulins specific features characterized by taxonomic origin from primates, e.g. man
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/20—Immunoglobulins specific features characterized by taxonomic origin
- C07K2317/24—Immunoglobulins specific features characterized by taxonomic origin containing regions, domains or residues from different species, e.g. chimeric, humanized or veneered
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/30—Immunoglobulins specific features characterized by aspects of specificity or valency
- C07K2317/31—Immunoglobulins specific features characterized by aspects of specificity or valency multispecific
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/30—Immunoglobulins specific features characterized by aspects of specificity or valency
- C07K2317/32—Immunoglobulins specific features characterized by aspects of specificity or valency specific for a neo-epitope on a complex, e.g. antibody-antigen or ligand-receptor
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/60—Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments
- C07K2317/62—Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments comprising only variable region components
- C07K2317/622—Single chain antibody (scFv)
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
- C07K2317/73—Inducing cell death, e.g. apoptosis, necrosis or inhibition of cell proliferation
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/90—Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
- C07K2317/92—Affinity (KD), association rate (Ka), dissociation rate (Kd) or EC50 value
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/01—Fusion polypeptide containing a localisation/targetting motif
- C07K2319/03—Fusion polypeptide containing a localisation/targetting motif containing a transmembrane segment
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/33—Fusion polypeptide fusions for targeting to specific cell types, e.g. tissue specific targeting, targeting of a bacterial subspecies
Definitions
- This invention pertains to antibody constructs that specifically bind MHC molecules complexed with HPV16-E7 peptides, and uses thereof including treating and diagnosing diseases.
- HPVs Human papillomaviruses
- Persistent infections with high- risk HPV types can lead to more serious cytological abnormalities or lesions that, if untreated, may progress to cancer.
- Annual incidence of HPV-associated cancers is >26,000 in the US (according to CDC) and >600,000 worldwide (Forman D. et al., Vaccine, 30: Suppl 5:F12-23, 2012).
- Different types of HPV are responsible for causing almost all cases of cervical cancer (Doorbar J., Clin.
- HPV human immunodeficiency virus
- HNSCC head and neck squamous cell carcinomas
- HPV-16 was found in 86.7% of the HPV-positive oropharyngeal SCCs, 68.2% of oral SCCs and 69.2% of laryngeal SCCs.
- RNA-Seq RNA sequencing
- E6 and E7 are intracellular proteins that have not been targeted by traditional drug development efforts using low molecular weight compounds or antibody approaches against cell surface proteins.
- Recent studies in HPV16-positive high-grade vulvar intraepithelial neoplasia have demonstrated T cell and clinical responses in 50% of patients treated with vaccination approaches that utilized E6/E7 peptides (Kenter G.G. et al., N. Engl. J. Med. 361: 1838-1847, 2009; Welters M.J. et al, N. Engl. J. Med. 361: 1838-1847, 2010; Daayana S. et al, Br. J. Cancer
- E7ii_i9 YMLDLQPET
- HPV- 16 transformed HLA-A*02:01 expressing cell lines in vitro Riemer A.B. et al., J. Biol. Chem. 285(38):29608-29622, 2010.
- This peptide is conserved in 16 out of 17 HPV-16 variants in the HPV database (Zhang G.L. et al, Database, 1-12, 2014).
- constructs (such as isolated constructs) that bind to a complex comprising an HPV16-E7 peptide and an MHC class I protein
- the constructs comprise an antibody moiety
- an anti-E7MC antibody moiety that specifically binds to a complex comprising an HPV16-E7 peptide and an MHC class I protein.
- an anti-E7MC construct (such as an isolated anti-E7MC construct) comprising an antibody moiety that specifically binds to a complex comprising an HPV16-E7 peptide and an MHC class I protein.
- the HPV16-E7/MHC class I complex is present on a cell surface. In some embodiments, the HPV16-E7/MHC class I complex is present on the surface of a cancer cell.
- the anti-E7MC construct comprises an antibody moiety that specifically binds to a complex comprising an HPV16-E7 peptide and an MHC class I protein, wherein the MHC class I protein is HLA-A.
- the MHC class I protein is HLA-A02.
- the MHC class I protein is the HLA-A*02:01 subtype of the HLA-A02 allele.
- the anti-E7MC construct comprises an antibody moiety that specifically binds to a complex comprising an HPV16-E7 peptide and an MHC class I protein, wherein the antibody moiety cross-reacts with a complex comprising the HPV16-E7 peptide and a second MHC class I protein having a different HLA allele than the MHC class I protein.
- the antibody moiety cross-reacts with a complex comprising a variant of the HPV16-E7 peptide comprising one amino acid substitution (such as a conservative amino acid substitution) and the MHC class I protein.
- the anti-E7MC construct comprises an antibody moiety that specifically binds to a complex comprising an HPV16-E7 peptide and an MHC class I protein, wherein the HPV16-E7 peptide is about 8 to about 12 (such as about any of 8, 9, 10, 11, or 12) amino acids in length.
- the HPV16-E7 peptide has an amino acid sequence selected from the group consisting of SEQ ID NOs: 3-14.
- the HPV16-E7 peptide has the amino acid sequence YMLDLQPET (SEQ ID NO: 4).
- the anti-E7MC construct comprises an antibody moiety that specifically binds to a complex comprising an HPV16-E7 peptide and an MHC class I protein, wherein the antibody moiety is a full-length antibody, a Fab, a Fab', a (Fab')2, an Fv, or a single chain Fv (scFv).
- the antibody moiety is fully human, semi- synthetic with human antibody framework regions, or humanized.
- the anti-E7MC construct comprises an antibody moiety that specifically binds to a complex comprising an HPV16-E7 peptide and an MHC class I protein, wherein the antibody moiety binds to the HPV16-E7/MHC class I complex with an equilibrium dissociation constant (3 ⁇ 4) between about 0.1 pM to about 500 nM (such as about any of 0.1 pM, 1.0 pM, 10 pM, 50 pM, 100 pM, 500 pM, 1 nM, 10 nM, 50 nM, 100 nM, or 500 nM, including any ranges between these values).
- the isolated anti-E7MC construct binds to the HPV16-E7/MHC class I complex with a K d between about 0.1 pM to about 500 nM (such as about any of 0.1 pM, 1.0 pM, 10 pM, 50 pM, 100 pM, 500 pM, 1 nM, 10 nM, 50 nM, 100 nM, or 500 nM, including any ranges between these values).
- the anti-E7MC construct comprises an antibody moiety that specifically binds to a complex comprising an HPV16-E7 peptide and an MHC class I protein, wherein the antibody moiety comprises: i) a heavy chain variable domain comprising a heavy chain complementarity determining region (HC-CDR) 1 comprising the amino acid sequence of G-F/G/Y-S/T-F-S/T-S-Y-A/G (SEQ ID NO: 183), or a variant thereof comprising up to about 3 (such as about any of 1, 2, or 3) amino acid substitutions, an HC- CDR2 comprising the amino acid sequence of I-N/I-P-X-X-G-G/T/I-T/A/P or I-S-X-S/D- G/N-G/S-N-T/I/K (SEQ ID NO: 184 or 185), or a variant thereof comprising up to about 3 (such as about any of 1, 2, or 3) amino acid
- the anti-E7MC construct comprises an antibody moiety that specifically binds to a complex comprising an HPV16-E7 peptide and an MHC class I protein, wherein the antibody moiety comprises: i) a heavy chain variable domain comprising an HC-CDR1 comprising (and in some embodiments consisting of) the amino acid sequence of any one of SEQ ID NOs: 57-77, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions, an HC-CDR2 comprising (and in some embodiments consisting of) the amino acid sequence of any one of SEQ ID NOs: 78-98, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions, and an HC-CDR3 comprising (and in some embodiments consisting of) the amino acid sequence of any one of SEQ ID NOs: 99-119, 244, and 245, or a variant thereof comprising up to
- the anti-E7MC construct comprises an antibody moiety that specifically binds to a complex comprising an HPV16-E7 peptide and an MHC class I protein, wherein the antibody moiety comprises: i) a heavy chain variable domain comprising an HC-CDR1 comprising (and in some embodiments consisting of) the amino acid sequence of any one of SEQ ID NOs: 57-77, an HC-CDR2 comprising (and in some embodiments consisting of) the amino acid sequence of any one of SEQ ID NOs: 78-98, and an HC-CDR3 comprising (and in some embodiments consisting of) the amino acid sequence of any one of SEQ ID NOs: 99-119, 244, and 245; or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions in the HC-CDR regions; and ii) a light chain variable domain comprising an LC-CDR1 comprising (and in some embodiments consist
- the anti-E7MC construct comprises an antibody moiety that specifically binds to a complex comprising an HPV16-E7 peptide and an MHC class I protein, wherein the antibody moiety comprises a) a heavy chain variable domain comprising (and in some embodiments consisting of) the amino acid sequence of any one of SEQ ID NOs: 15-35 and 233-237 or a variant thereof having at least about 95% (such as at least about any of 95%, 96%, 97%, 98%, or 99%) sequence identify to any one of SEQ ID NOs: 15-35 and 233-237; and b) a light chain variable domain comprising (and in some embodiments consisting of) the amino acid sequence of any one of SEQ ID NOs: 36-56 and 238-243 or a variant thereof having at least about 95% (such as at least about any of 95%, 96%, 97%, 98%, or 99%) sequence identity to any one of SEQ ID NOs: 36-56 and 238-243.
- the antibody moiety comprises a heavy chain variable domain comprising (and in some embodiments consisting of) the amino acid sequence of any one of SEQ ID NOs: 15- 35 and 233-237 and a light chain variable domain comprising (and in some embodiments consisting of) the amino acid sequence of any one of SEQ ID NOs: 36-56 and 238-243.
- the anti-E7MC construct comprises a first antibody moiety that competes for binding to a target HPV16-E7/MHC class I complex with a second antibody moiety according to any of the antibody moieties described above. In some embodiments, the first antibody moiety binds to the same, or substantially the same, epitope as the second antibody moiety.
- binding of the first antibody moiety to the target HPV16-E7/MHC class I complex inhibits binding of the second antibody moiety to the target HPV16-E7/MHC class I complex by at least about 70% (such as by at least about any of 75%, 80%, 85%, 90%, 95%, 98% or 99%), or vice versa.
- the first antibody moiety and the second antibody moiety cross-compete for binding to the target HPV16-E7/MHC class I complex, i.e., each of the first and second antibody moieties competes with the other for binding to the target HPV16-E7/MHC class I complex.
- the isolated anti-E7MC construct is a full-length antibody.
- the isolated anti-E7MC construct is monospecific.
- the isolated anti-E7MC construct is multi- specific.
- the isolated anti-E7MC construct is bispecific.
- the isolated anti-E7MC molecule is a tandem scFv, a diabody (Db), a single chain diabody (scDb), a dual-affinity retargeting (DART) antibody, a dual variable domain (DVD) antibody, a knob-into-hole (KiH) antibody, a dock and lock (DNL) antibody, a chemically cross-linked antibody, a heteromultimeric antibody, or a heteroconjugate antibody.
- the isolated anti-E7MC construct is a tandem scFv comprising two scFvs linked by a peptide linker.
- the peptide linker comprises (and in some embodiments consists of) the amino acid sequence GGGGS.
- the anti-E7MC construct comprises an antibody moiety that specifically binds to a complex comprising an HPV16-E7 peptide and an MHC class I protein, wherein the isolated anti-E7MC construct further comprises a second antigen- binding moiety that specifically binds to a second antigen.
- the second antigen-binding moiety is an antibody moiety.
- the second antigen is an antigen on the surface of a T cell.
- the T cell is selected from the group consisting of a cytotoxic T cell, a helper T cell, and a natural killer T cell.
- the second antigen is selected from the group consisting of CD3y, CD35,
- the second antigen is CD3s
- the isolated anti-E7MC construct is a tandem scFv comprising an N-terminal scFv specific for the HPV16-E7/MHC class I complex and a C-terminal scFv specific for CD3s.
- the second antigen is an antigen on the surface of a natural killer cell, a neutrophil, a monocyte, a macrophage, or a dendritic cell.
- the anti-E7MC construct comprises an antibody moiety that specifically binds to a complex comprising an HPV16-E7 peptide and an MHC class I protein, wherein the isolated anti-E7MC construct is a chimeric antigen receptor (CAR).
- the chimeric antigen receptor comprises an extracellular domain comprising the antibody moiety, a transmembrane domain, and an intracellular signaling domain.
- the intracellular signaling domain comprises a CD3 ⁇ intracellular signaling sequence and a co- stimulatory signaling sequence.
- the co-stimulatory signaling sequence is a CD28 intracellular signaling sequence.
- the anti-E7MC construct comprises an antibody moiety that specifically binds to a complex comprising an HPV16-E7 peptide and an MHC class I protein, wherein the isolated anti-E7MC construct is an immunoconjugate comprising the antibody moiety and an effector molecule.
- the effector molecule is a therapeutic agent selected from the group consisting of a drug, a toxin, a radioisotope, a protein, a peptide, and a nucleic acid.
- the therapeutic agent is a drug or a toxin.
- the effector molecule is a label.
- a pharmaceutical composition comprising an anti-E7MC construct (such as an isolated anti-E7MC construct) according to any of the embodiments described above.
- the pharmaceutical composition further comprises a cell (such as an effector cell) associated with the anti-E7MC construct.
- a host cell expressing or associated with an anti-E7MC construct, or polypeptide component thereof.
- a nucleic acid encoding an anti-E7MC construct, or polypeptide component thereof.
- a vector comprising the nucleic acid.
- an effector cell expressing or associated with an anti-E7MC construct.
- the effector cell is a T cell.
- a method of detecting a cell presenting a complex comprising an HPV16-E7 peptide and an MHC class I protein on its surface comprising contacting the cell with an anti-E7MC construct (such as an isolated anti-E7MC construct) according to any of the embodiments described above comprising a) an antibody moiety that specifically binds to a complex comprising the HPV16-E7 peptide and the MHC class I protein and b) a label, and detecting the presence of the label on the cell.
- an anti-E7MC construct such as an isolated anti-E7MC construct
- a method of treating an individual having an HPV16-E7-positive disease comprising administering to the individual an effective amount of a pharmaceutical composition comprising an anti-E7MC construct (such as an isolated anti-E7MC construct) according to any of the embodiments described above.
- the pharmaceutical composition further comprises a cell (such as an effector cell) associated with the isolated anti-E7MC construct.
- a method of treating an individual having an HPV16-E7-positive disease comprising administering to the individual an effective amount of an effector cell expressing any of the anti-E7MC CARs described above.
- the effector cell is a T cell.
- the HPV16-E7-positive disease is cancer.
- the cancer is squamous cell carcinoma, cervical cancer, anal cancer, vaginal cancer, vulvar cancer, penile cancer, head and neck cancer, or oropharyngeal cancer.
- the cancer is an HPV16-E7-positive squamous cell carcinoma (SCC).
- a method of diagnosing an individual having an HPV16-E7-positive disease comprising: a) administering an effective amount of an isolated anti-E7MC construct comprising a label according to any of the embodiments described above to the individual; and b) determining the level of the label in the individual, wherein a level of the label above a threshold level indicates that the individual has the
- a method of diagnosing an individual having an HPV16-E7-positive disease comprising: a) contacting a sample derived from the individual with an isolated anti-E7MC construct comprising a label according to any of the embodiments described above; and b) determining the number of cells bound with the isolated anti-E7MC construct in the sample, wherein a value for the number of cells bound with the isolated anti-E7MC construct above a threshold level indicates that the individual has the HPV16-E7-positive disease.
- HPV16-E7-positive disease is cancer.
- the cancer is squamous cell carcinoma, cervical cancer, anal cancer, vaginal cancer, vulvar cancer, penile cancer, head and neck cancer, or oropharyngeal cancer.
- the cancer is an HPV16- E7-positive squamous cell carcinoma (SCC).
- FIG. 1 shows the size exclusion chromatography (SEC) chromatogram of HPV16-E7 11-19 peptide/HLA-A*02:01 complex following concentration by ultrafiltration.
- SEC size exclusion chromatography
- FIG. 2 shows the results of phage clone ELIS A for specific binding of biotinylated HPV16-E7 11-19 peptide/HLA-A*02:01 versus biotinylated C3 control peptide/HLA- A*02:01.
- FIG. 3 shows the results of phage clone FACS binding assays for binding of HPV16- E7 11-19 peptide-loaded T2 cells versus C3 control peptide-loaded T2 cells.
- 1 Cell only negative control
- 2 2° antibody only control
- 3 HPV16-E7 11-19 peptide/HLA-A*02:01- specific antibody phage clone.
- FIG. 4 shows the results of phage clone #11 FACS binding assays for T2 cells loaded with HPV16-E7 11-19 peptides having a single alanine substitution at position 1, 5, or 8.
- 1 Cell only negative control
- 2 2° antibody only control
- 3 HPV16-E7 11-19 peptide/HLA- A*02:01 -specific antibody phage clone #11.
- FIG. 5 shows the results of phage clone FACS binding assays for binding of HPV16- E7 11-19 peptide-loaded T2 cells versus T2 cells loaded with peptides derived from normally expressed endogenous proteins.
- the peptides loaded from left to right are HPV16-E7 11-19, A2E1, A2E2, A2E3, A2E4, A2E5, A2E6, A2E7, A2E8, A2E9, A2E11, and A2E17.
- FIG. 6 shows SDS-PAGE analysis for determining purity of anti-HPV16-E7 11- 19/MHC bispecific antibodies.
- FIG. 7 shows the T-cell killing of HPV16-E7 11-19 peptide-loaded T2 cells mediated by anti-HPV16-E7 11-19/HLA-A*02:01 bispecific antibodies prepared from various phage clones at 1 ⁇ g/ml and 0.2 ⁇ g/ml.
- Negative controls include T2 cells loaded with AFP158 peptide and bispecific antibody specific for AFP158/HLA-A*02:01.
- the peptides loaded from left to right are 1 ⁇ g/ml HPV16-E7 11-19, 1 ⁇ g/ml AFP158, 0.2 ⁇ g/ml HPV16-E7 11-19, and 0.2 ⁇ g/ml AFP158.
- NC peptide AFP158 peptide; NC
- Antibody anti-AFP158/HLA-A*02:01 bispecific antibody.
- FIG. 8A shows the T-cell killing of two cancer cell lines (CaSki and MS-751) mediated by anti-HPV16-E7 11-19/MHC bispecific antibodies (BsAb).
- FIG. 8B shows the dose-dependence for T-cell killing of two cancer cell lines (CaSki and MS-751) mediated by anti-HPV16-E7 11-19/MHC bispecific antibodies (BsAb) at varying BsAb concentrations.
- FIG. 9 shows a schematic representation of a chimeric antigen receptor construct.
- FIGS. 10A and 10B show the results of BsAb FACS binding assays for T2 cells loaded with HPV16-E7 11-19 peptides having a WT sequence or a single alanine substitution at positions 1-9.
- FIG. 10A shows results for BsAbs based on clones US-7, 7-1, 7-3, and 7-6.
- FIG. 10B shows results for BsAbs based on clones 7-7 and 7-8.
- FIGS. 1 lA-11C show flow cytometry analysis of T cells transduced with various CARs having an anti-HPV16-E7 affinity matured or parental scFv; cells were stained with HPV16-E7 11-19 peptide /HLA-A*02:01 tetramers and co-stained with anti-CD4 antibody and anti-CD8 antibody.
- FIG. 11A shows flow cytometry analysis for US-7 4- IBB, 7-1 4- 1BB, 7-3 4-1BB, 7-6 4-1BB, 7-7 4-1BB, and 7-8 4-1BB CAR-T cells.
- FIG. 11B shows flow cytometry analysis for 7-9 4-1BB, US-7 CD28, 7-1 CD28, 7-3 CD28, 7-6 CD28, and 7-7 CD28 CAR-T cells.
- FIG. 11C show flow cytometry analysis for 7-8 CD28 and 7-9 CD28 CAR-T cells, and mock- transduced T cells.
- FIG. 12 shows the killing of cancer cell lines positive for HLA-A*02:01 and either positive or negative for HPV16-E7, mediated by T cells expressing an anti-HPV16-E7/HLA- A*02:01 CAR having an affinity matured or parental scFv. Mock-transduced cells were included as controls.
- anti-E7MC constructs that comprise an antibody moiety (referred to herein as an "anti-E7MC antibody moiety") that specifically binds to a complex comprising an HPV16-E7 peptide and an MHC class I protein (referred to herein as an "HPV16-E7/MHC class I complex," or "E7MC").
- the anti-E7MC constructs specifically recognize HPV16-E7/MHC class I complexes, such as MHC-presented HPV16-E7 peptides on the surface of cells expressing HPV16-E7.
- Anti- E7MC constructs may specifically bind to the N-terminal portion, the C-terminal portion, or the middle portion of the HPV16-E7 peptide in the complex, and/or cross-react with at least one complex comprising the HPV16-E7 peptide and a different subtype of the MHC class I protein (e.g. , the anti-E7MC construct binds to both an HPV16-E7 peptide/HLA-A*02:01 complex and an HPV16-E7 peptide/HLA-A*02:02 complex).
- the anti-E7MC constructs allow for specific targeting of E7MC-presenting cells (i.e.
- cells presenting on their surface an HPV16-E7 peptide bound to an MHC molecule such as disease cells expressing HPV16-E7.
- This strategy provides a significant technical advantage over using antibodies directed against the HPV16-E7 protein, which cannot specifically target E7MC-presenting cells.
- the anti-E7MC antibody moiety allows for diagnosis and prognosis of HPV16-E7-positive diseases or disorders with high sensitivity to changes in the number and distribution of E7MC-presenting cells, a potentially more relevant measure of disease progression than circulating HPV16-E7 levels.
- the present application thus provides constructs (such as isolated constructs) comprising an antibody moiety that specifically binds to a complex comprising an HPV16-E7 peptide and an MHC class I protein.
- the construct can be, for example, a full-length anti- E7MC antibody, a multi- specific anti-E7MC molecule (such as a bispecific anti-E7MC antibody), an anti-E7MC chimeric antigen receptor ("CAR”), or an anti-E7MC
- nucleic acids encoding the anti-E7MC constructs or the anti-E7MC antibody moiety portion of the constructs.
- compositions comprising an anti-E7MC construct comprising an antibody moiety that specifically binds to a complex comprising an HPV16-E7-peptide and an MHC class I protein.
- the composition can be a pharmaceutical composition comprising an anti-E7MC construct or an effector cell expressing or associated with the anti-E7MC construct (for example a T cell expressing an anti-E7MC CAR).
- kits and articles of manufacture useful for such methods.
- treatment is an approach for obtaining beneficial or desired results, including clinical results.
- beneficial or desired clinical results include, but are not limited to, one or more of the following: alleviating one or more symptoms resulting from the disease, diminishing the extent of the disease, stabilizing the disease (e.g. , preventing or delaying the worsening of the disease), preventing or delaying the spread (e.g.
- metastasis of the disease, preventing or delaying the recurrence of the disease, delay or slowing the progression of the disease, ameliorating the disease state, providing a remission (partial or total) of the disease, decreasing the dose of one or more other medications required to treat the disease, delaying the progression of the disease, increasing or improving the quality of life, increasing weight gain, and/or prolonging survival.
- treatment is a reduction of pathological consequence of cancer (such as, for example, tumor volume).
- the methods of the invention contemplate any one or more of these aspects of treatment.
- recurrence refers to the return of a cancer or disease after clinical assessment of the disappearance of disease. A diagnosis of distant metastasis or local recurrence can be considered a relapse.
- the term "refractory” or “resistant” refers to a cancer or disease that has not responded to treatment.
- Activation refers to the state of a T cell that has been sufficiently stimulated to induce detectable cellular proliferation. Activation can also be associated with induced cytokine production, and detectable effector functions.
- antibody moiety includes full-length antibodies and antigen-binding fragments thereof.
- a full-length antibody comprises two heavy chains and two light chains.
- the variable regions of the light and heavy chains are responsible for antigen binding.
- the variables region in both chains generally contain three highly variable loops called the complementarity determining regions (CDRs) (light chain (LC) CDRs including LC-CDR1, LC-CDR2, and LC-CDR3, heavy chain (HC) CDRs including HC-CDR1, HC-CDR2, and HC-CDR3).
- CDRs complementarity determining regions
- CDR boundaries for the antibodies and antigen-binding fragments disclosed herein may be defined or identified by the conventions of Kabat, Chothia, or Al-Lazikani (Al- Lazikani 1997; Chothia 1985; Chothia 1987; Chothia 1989; Kabat 1987; Kabat 1991).
- the three CDRs of the heavy or light chains are interposed between flanking stretches known as framework regions (FRs), which are more highly conserved than the CDRs and form a scaffold to support the hypervariable loops.
- FRs framework regions
- the constant regions of the heavy and light chains are not involved in antigen binding, but exhibit various effector functions.
- Antibodies are assigned to classes based on the amino acid sequence of the constant region of their heavy chain.
- the five major classes or isotypes of antibodies are IgA, IgD, IgE, IgG, and IgM, which are characterized by the presence of ⁇ , ⁇ , ⁇ , ⁇ , and ⁇ heavy chains, respectively.
- lgGl ⁇ heavy chain
- lgG2 ⁇ 2 heavy chain
- lgG3 ⁇ 3 heavy chain
- lgG4 ⁇ 4 heavy chain
- IgAl al heavy chain
- lgA2 a2 heavy chain
- antigen-binding fragment refers to an antibody fragment including, for example, a diabody, a Fab, a Fab', a F(ab')2, an Fv fragment, a disulfide stabilized Fv fragment (dsFv), a (dsFv)2, a bispecific dsFv (dsFv-dsFv'), a disulfide stabilized diabody (ds diabody), a single-chain antibody molecule (scFv), an scFv dimer (bivalent diabody), a multispecific antibody formed from a portion of an antibody comprising one or more CDRs, a camelized single domain antibody, a nanobody, a domain antibody, a bivalent domain antibody, or any other antibody fragment that binds to an antigen but does not comprise a complete antibody structure.
- an antigen-binding fragment is capable of binding to the same antigen to which the parent antibody or a parent antibody fragment (e.g. , a parent scFv) binds.
- an antigen-binding fragment may comprise one or more CDRs from a particular human antibody grafted to a framework region from one or more different human antibodies.
- epitope refers to the specific group of atoms or amino acids on an antigen to which an antibody or antibody moiety binds. Two antibodies or antibody moieties may bind the same epitope within an antigen if they exhibit competitive binding for the antigen.
- a first antibody moiety "competes" for binding to a target E7MC with a second antibody moiety when the first antibody moiety inhibits target E7MC binding of the second antibody moiety by at least about 50% (such as at least about any of 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 98% or 99%) in the presence of an equimolar
- the term “specifically binds” or “is specific for” refers to measurable and reproducible interactions, such as binding between a target and an antibody or antibody moiety, that is determinative of the presence of the target in the presence of a heterogeneous population of molecules, including biological molecules.
- an antibody or antibody moiety that specifically binds to a target is an antibody or antibody moiety that binds this target with greater affinity, avidity, more readily, and/or with greater duration than its bindings to other targets.
- an antibody or antibody moiety that specifically binds to an antigen reacts with one or more antigenic determinants of the antigen (for example an HPV16-E7 peptide/MHC class I protein complex) with a binding affinity that is at least about 10 times its binding affinity for other targets.
- one or more antigenic determinants of the antigen for example an HPV16-E7 peptide/MHC class I protein complex
- An "isolated" anti-E7MC construct as used herein refers to an anti-E7MC construct that (1) is not associated with proteins found in nature, (2) is free of other proteins from the same source, (3) is expressed by a cell from a different species, or, (4) does not occur in nature.
- isolated nucleic acid as used herein is intended to mean a nucleic acid of genomic, cDNA, or synthetic origin or some combination thereof, which by virtue of its origin the "isolated nucleic acid” (1) is not associated with all or a portion of a polynucleotide in which the "isolated nucleic acid” is found in nature, (2) is operably linked to a
- polynucleotide which it is not linked to in nature, or (3) does not occur in nature as part of a larger sequence.
- CDR complementarity determining region
- V H CDR3 95- 102 96- 101 93- 101
- Residue numbering follows the nomenclature of Kabat et al., supra
- chimeric antibodies refer to antibodies in which a portion of the heavy and/or light chain is identical with or homologous to corresponding sequences in antibodies derived from a particular species or belonging to a particular antibody class or subclass, while the remainder of the chain(s) is identical with or homologous to corresponding sequences in antibodies derived from another species or belonging to another antibody class or subclass, as well as fragments of such antibodies, so long as they exhibit a biological activity of this invention (see U.S. Patent No. 4,816,567; and Morrison et al., Proc. Natl. Acad. Sci. USA, 81 :6851-6855 (1984)).
- si- synthetic in reference to an antibody or antibody moiety means that the antibody or antibody moiety has one or more naturally occurring sequences and one or more non-naturally occurring ⁇ i.e., synthetic) sequences.
- Fv is the minimum antibody fragment which contains a complete antigen- recognition and -binding site. This fragment consists of a dimer of one heavy- and one light- chain variable region domain in tight, non-covalent association. From the folding of these two domains emanate six hypervariable loops (3 loops each from the heavy and light chain) that contribute the amino acid residues for antigen binding and confer antigen binding specificity to the antibody. However, even a single variable domain (or half of an Fv comprising only three CDRs specific for an antigen) has the ability to recognize and bind antigen, although at a lower affinity than the entire binding site.
- Single-chain Fv also abbreviated as “sFv” or “scFv,” are antibody fragments that comprise the VJJ and VL antibody domains connected into a single polypeptide chain.
- the scFv polypeptide further comprises a polypeptide linker between the Vf j and VL domains which enables the scFv to form the desired structure for antigen binding.
- diabodies refers to small antibody fragments prepared by constructing scFv fragments (see preceding paragraph) typically with short linkers (such as about 5 to about 10 residues) between the VJJ and VL domains such that inter-chain but not intra-chain pairing of the V domains is achieved, resulting in a bivalent fragment, i.e., fragment having two antigen-binding sites.
- Bispecific diabodies are heterodimers of two "crossover" scFv fragments in which the VJJ and VL domains of the two antibodies are present on different polypeptide chains.
- Diabodies are described more fully in, for example, EP 404,097; WO 93/11161; and Hollinger et al, Proc. Natl. Acad. Sci. USA, 90:6444-6448 (1993).
- humanized forms of non-human (e.g., rodent) antibodies are chimeric antibodies that contain minimal sequence derived from the non-human antibody.
- humanized antibodies are human immunoglobulins (recipient antibody) in which residues from a hypervariable region (HVR) of the recipient are replaced by residues from a hypervariable region of a non-human species (donor antibody) such as mouse, rat, rabbit or non-human primate having the desired antibody specificity, affinity, and capability.
- donor antibody such as mouse, rat, rabbit or non-human primate having the desired antibody specificity, affinity, and capability.
- framework region (FR) residues of the human immunoglobulin are replaced by corresponding non-human residues.
- humanized antibodies can comprise residues that are not found in the recipient antibody or in the donor antibody.
- the humanized antibody will comprise substantially all of at least one, and typically two, variable domains, in which all or substantially all of the hypervariable loops correspond to those of a non- human immunoglobulin and all or substantially all of the FRs are those of a human immunoglobulin sequence.
- the humanized antibody optionally also will comprise at least a portion of an immunoglobulin constant region (Fc), typically that of a human immunoglobulin.
- Fc immunoglobulin constant region
- Percent (%) amino acid sequence identity or "homology” with respect to the polypeptide and antibody sequences identified herein is defined as the percentage of amino acid residues in a candidate sequence that are identical with the amino acid residues in the polypeptide being compared, after aligning the sequences considering any conservative substitutions as part of the sequence identity. Alignment for purposes of determining percent amino acid sequence identity can be achieved in various ways that are within the skill in the art, for instance, using publicly available computer software such as BLAST, BLAST-2, ALIGN, Megalign (DNASTAR), or MUSCLE software. Those skilled in the art can determine appropriate parameters for measuring alignment, including any algorithms needed to achieve maximal alignment over the full-length of the sequences being compared.
- % amino acid sequence identity values are generated using the sequence comparison computer program MUSCLE (Edgar, R.C., Nucleic Acids Research 32(5): 1792-1797, 2004; Edgar, R.C., BMC Bioinformatics 5(1): 113, 2004).
- an FcR of this invention is one that binds an IgG antibody (a ⁇ receptor) and includes receptors of the FcyRI, FcyRII, and FcyRIII subclasses, including allelic variants and alternatively spliced forms of these receptors.
- FcyRII receptors include FcyRIIA (an “activating receptor”) and FcyRIIB (an “inhibiting receptor”), which have similar amino acid sequences that differ primarily in the cytoplasmic domains thereof.
- Activating receptor FcyRIIA contains an immunoreceptor tyrosine-based activation motif (IT AM) in its cytoplasmic domain.
- Inhibiting receptor FcyRIIB contains an immunoreceptor tyrosine-based inhibition motif (ITIM) in its cytoplasmic domain (see review M. in Daeron, Annu. Rev. Immunol. 15:203-234 (1997)).
- FcyRIIIA allotypes FcYRIIIA-Phel58, FcYRIIIA-Vall58, FcyRIIA-R131 and/or FCYRIIA-H131.
- FCRS are reviewed in Ravetch and Kinet, Annu. Rev. Immunol 9:457-92 (1991); Capel et ah, Immunomethods 4:25-34 (1994); and de Haas et ah, J. Lab. Clin. Med. 126:330-41 (1995).
- Other FcRs including those to be identified in the future, are
- FcR neonatal receptor
- FcRn the neonatal receptor
- MHC major histocompatibility complex
- FcRn plays a role in the passive delivery of immunoglobulin IgGs from mother to young and the regulation of serum IgG levels. FcRn can act as a salvage receptor, binding and transporting pinocytosed IgGs in intact form both within and across cells, and rescuing them from a default degradative pathway.
- the "CHI domain” of a human IgG Fc region (also referred to as "CI” of "HI” domain) usually extends from about amino acid 118 to about amino acid 215 (EU numbering system).
- Hinge region is generally defined as stretching from Glu216 to Pro230 of human IgGl (Burton, Molec. Immunol.22: l6l-206 (1985)). Hinge regions of other IgG isotypes may be aligned with the IgGl sequence by placing the first and last cysteine residues forming inter-heavy chain S-S bonds in the same positions.
- the "CH2 domain" of a human IgG Fc region usually extends from about amino acid 231 to about amino acid 340.
- the CH2 domain is unique in that it is not closely paired with another domain. Rather, two N-linked branched carbohydrate chains are interposed between the two CH2 domains of an intact native IgG molecule. It has been speculated that the carbohydrate may provide a substitute for the domain-domain pairing and help stabilize the CH2 domain.
- CH3 domain (also referred to as “C2" or “H3” domain) comprises the stretch of residues C-terminal to a CH2 domain in an Fc region ⁇ i.e. from about amino acid residue 341 to the C-terminal end of an antibody sequence, typically at amino acid residue 446 or 447 of an IgG).
- a "functional Fc fragment” possesses an "effector function” of a native sequence Fc region.
- effector functions include Clq binding; complement dependent cytotoxicity (CDC); Fc receptor binding; antibody-dependent cell-mediated cytotoxicity (ADCC); phagocytosis; down regulation of cell surface receptors ⁇ e.g. B cell receptor; BCR), etc.
- Such effector functions generally require the Fc region to be combined with a binding domain (e.g. an antibody variable domain) and can be assessed using various assays known in the art.
- An antibody with a variant IgG Fc with "altered" FcR binding affinity or ADCC activity is one which has either enhanced or diminished FcR binding activity (e.g., FcyR or FcRn) and/or ADCC activity compared to a parent polypeptide or to a polypeptide comprising a native sequence Fc region.
- the variant Fc which "exhibits increased binding" to an FcR binds at least one FcR with higher affinity (e.g., lower apparent K d or IC 50 value) than the parent polypeptide or a native sequence IgG Fc.
- the improvement in binding compared to a parent polypeptide is about 3 fold, such as about any of 5, 10, 25, 50, 60, 100, 150, 200, or up to 500 fold, or about 25% to 1000% improvement in binding.
- the polypeptide variant which "exhibits decreased binding" to an FcR binds at least one FcR with lower affinity (e.g., higher apparent K d or higher IC 50 value) than a parent polypeptide.
- the decrease in binding compared to a parent polypeptide may be about 40% or more decrease in binding.
- ADCC antibody-dependent cell-mediated cytotoxicity
- FcRs Fc receptors
- cytotoxic cells e.g. Natural Killer (NK) cells, neutrophils, and macrophages
- NK cells Natural Killer cells
- neutrophils neutrophils
- macrophages cytotoxic cells
- the antibodies “arm” the cytotoxic cells and are absolutely required for such killing.
- the primary cells for mediating ADCC, NK cells express FcyRIII only, whereas monocytes express FcyRI, FcyRII and FcyRIII.
- FcR expression on cytotoxic cells e.g. Natural Killer (NK) cells, neutrophils, and macrophages
- ADCC activity of a molecule of interest is assessed in vivo, e.g., in an animal model such as that disclosed in Clynes et al. PNAS (USA) 95:652-656 (1998).
- polypeptide comprising a variant Fc region which "exhibits increased ADCC” or mediates antibody-dependent cell-mediated cytotoxicity (ADCC) in the presence of human effector cells more effectively than a polypeptide having wild type IgG Fc or a parent polypeptide is one which in vitro or in vivo is substantially more effective at mediating
- ADCC when the amounts of polypeptide with variant Fc region and the polypeptide with wild type Fc region (or the parent polypeptide) in the assay are essentially the same.
- variants will be identified using any in vitro ADCC assay known in the art, such as assays or methods for determining ADCC activity, e.g. in an animal model etc.
- the variant is from about 5 fold to about 100 fold, e.g. from about 25 to about 50 fold, more effective at mediating ADCC than the wild type Fc (or parent polypeptide) .
- CDC complement dependent cytotoxicity
- Activation of the classical complement pathway is initiated by the binding of the first component of the complement system (Clq) to antibodies (of the appropriate subclass) which are bound to their cognate antigen.
- Clq first component of the complement system
- a CDC assay e.g. as described in Gazzano-Santoro et ah, J. Immunol. Methods 202: 163 (1996), may be performed.
- Polypeptide variants with altered Fc region amino acid sequences and increased or decreased Clq binding capability are described in US patent No. 6,194,551B 1 and W099/51642. The contents of those patent publications are specifically incorporated herein by reference. See, also, Idusogie et al. J. Immunol. 164: 4178-4184 (2000).
- nucleotide sequence encoding an amino acid sequence includes all nucleotide sequences that are degenerate versions of each other and that encode the same amino acid sequence.
- the phrase nucleotide sequence that encodes a protein or an RNA may also include introns to the extent that the nucleotide sequence encoding the protein may in some version contain an intron(s).
- operably linked refers to functional linkage between a regulatory sequence and a heterologous nucleic acid sequence resulting in expression of the latter.
- a first nucleic acid sequence is operably linked with a second nucleic acid sequence when the first nucleic acid sequence is placed in a functional relationship with the second nucleic acid sequence.
- a promoter is operably linked to a coding sequence if the promoter affects the transcription or expression of the coding sequence.
- operably linked DNA sequences are contiguous and, where necessary to join two protein coding regions, in the same reading frame.
- homologous refers to the sequence similarity or sequence identity between two polypeptides or between two nucleic acid molecules. When a position in both of the two compared sequences is occupied by the same base or amino acid monomer subunit, e.g., if a position in each of two DNA molecules is occupied by adenine, then the molecules are homologous at that position.
- the percent of homology between two sequences is a function of the number of matching or homologous positions shared by the two sequences divided by the number of positions compared times 100. For example, if 6 of 10 of the positions in two sequences are matched or homologous then the two sequences are 60% homologous.
- the DNA sequences ATTGCC and TATGGC share 50% homology. Generally, a comparison is made when two sequences are aligned to give maximum homology.
- an “effective amount” of an anti-E7MC construct or composition as disclosed herein is an amount sufficient to carry out a specifically stated purpose.
- An “effective amount” can be determined empirically and by known methods relating to the stated purpose.
- the term "therapeutically effective amount” refers to an amount of an anti-E7MC construct or composition as disclosed herein, effective to "treat” a disease or disorder in an individual.
- the therapeutically effective amount of the anti-E7MC construct or composition as disclosed herein can reduce the number of cancer cells; reduce the tumor size or weight; inhibit (i.e. , slow to some extent and preferably stop) cancer cell infiltration into peripheral organs; inhibit (i.e. , slow to some extent and preferably stop) tumor metastasis; inhibit, to some extent, tumor growth; and/or relieve to some extent one or more of the symptoms associated with the cancer.
- the anti-E7MC construct or composition as disclosed herein can prevent growth and/or kill existing cancer cells, it can be cytostatic and/or cytotoxic.
- the therapeutically effective amount is a growth inhibitory amount.
- the therapeutically effective amount is an amount that extends the survival of a patient.
- the therapeutically effective amount is an amount that improves progression free survival of a patient.
- pharmaceutically acceptable or “pharmacologically compatible” is meant a material that is not biologically or otherwise undesirable, e.g. , the material may be incorporated into a pharmaceutical composition administered to a patient without causing any significant undesirable biological effects or interacting in a deleterious manner with any of the other components of the composition in which it is contained.
- Pharmaceutically acceptable carriers or excipients have preferably met the required standards of toxicological and manufacturing testing and/or are included on the Inactive Ingredient Guide prepared by the U.S. Food and Drug administration.
- label when used herein refers to a detectable compound or composition which can be conjugated directly or indirectly to the anti-E7MC antibody moiety.
- the label may be detectable by itself (e.g., radioisotope labels or fluorescent labels) or, in the case of an enzymatic label, may catalyze chemical alteration of a substrate compound or composition which is detectable.
- Reference to "about” a value or parameter herein includes (and describes) variations that are directed to that value or parameter per se. For example, description referring to "about X” includes description of "X”.
- reference to "not" a value or parameter generally means and describes "other than” a value or parameter.
- the method is not used to treat cancer of type X means the method is used to treat cancer of types other than X.
- the present invention provides HPV16-E7/MHC class I complex- specific constructs (anti-E7MC constructs) that comprise an antibody moiety that specifically binds to a complex comprising an HPV16-E7 peptide and an MHC class I protein ("HPV16- E7/MHC class I complex," or "E7MC").
- anti-E7MC constructs that comprise an antibody moiety that specifically binds to a complex comprising an HPV16-E7 peptide and an MHC class I protein
- E7MC MHC class I protein
- reference to a moiety that specifically binds to a complex comprising an HPV16-E7 peptide and an MHC class I protein means that the moiety binds to the E7MC with a) an affinity that is at least about 10 (including for example at least about any of 10, 20, 30, 40, 50, 75, 100, 200, 300, 400, 500, 750, 1000 or more) times its binding affinity for each of full-length HPV16-E7, free HPV16-E7 peptide, MHC class I protein not bound to a peptide, and MHC class I protein bound to a non-HPV16-E7 peptide; or b) a K d no more than about 1/10 (such as no more than about any of 1/10, 1/20, 1/30, 1/40, 1/50, 1/75, 1/100, 1/200, 1/300, 1/400, 1/500, 1/750, 1/1000 or less) times its K d for binding to each of full- length
- Binding affinity can be determined by methods known in the art, such as ELISA, fluorescence activated cell sorting (FACS) analysis, or radioimmunoprecipitation assay (RIA).
- K d can be determined by methods known in the art, such as surface plasmon resonance (SPR) assay utilizing, for example, Biacore instruments, or kinetic exclusion assay (KinExA) utilizing, for example, Sapidyne instruments.
- SPR surface plasmon resonance
- KinExA kinetic exclusion assay
- Contemplated anti-E7MC constructs include, for example, full-length anti-E7MC antibodies, multi- specific (such as bispecific) anti-E7MC molecules, anti-E7MC chimeric antigen receptors (CARs), and anti-E7MC immunoconjugates.
- an anti-E7MC construct (such as an isolated anti-E7MC construct) comprising an anti-E7MC antibody moiety that specifically binds to a complex comprising an HPV16-E7 peptide and an MHC class I protein.
- the HPV16-E7 peptide is HPV16-E7 11-19 (SEQ ID NO: 4).
- the MHC class I protein is HLA-A02.
- the MHC class I protein is HLA-A*02:01 (GenBank Accession No.: AAO20853).
- the anti-E7MC construct is non-naturally occurring.
- the anti-E7MC construct is a full-length antibody. In some embodiments, the anti-E7MC construct is a multi- specific (such as bispecific) molecule. In some embodiments, the anti- E7MC construct is a chimeric antigen receptor. In some embodiments, the anti-E7MC construct is an immunoconjugate.
- the anti-E7MC construct binds the E7MC with a K d between about 0.1 pM to about 500 nM (such as about any of 0.1 pM, 1.0 pM, 10 pM, 50 pM, 100 pM, 500 pM, 1 nM, 10 nM, 50 nM, 100 nM, or 500 nM, including any ranges between these values).
- the anti-E7MC construct cross- reacts with at least one (such as at least any of 2, 3, 4, 5, or 6) complex comprising the MHC class I protein and a variant of the HPV16-E7 peptide having one amino acid substitution (such as a conservative amino acid substitution).
- the anti-E7MC construct cross-reacts with at least one (such as at least any of 2, 3, 4, or 5) complex comprising the HPV16-E7 peptide and a different subtype of the MHC class I protein.
- an anti-E7MC construct comprising an anti- E7MC antibody moiety that specifically binds to a complex comprising an HPV16-E7 11-19 peptide (SEQ ID NO: 4) and HLA-A*02:01.
- the anti-E7MC construct is non-naturally occurring.
- the anti-E7MC construct is a full-length antibody.
- the anti-E7MC construct is a multi- specific (such as bispecific) molecule.
- the anti-E7MC construct is a chimeric antigen receptor.
- the anti-E7MC construct is an immunoconjugate.
- the anti-E7MC construct binds the E7MC with a K d between about 0.1 pM to about 500 nM (such as about any of 0.1 pM, 1.0 pM, 10 pM, 50 pM, 100 pM, 500 pM, 1 nM, 10 nM, 50 nM, 100 nM, or 500 nM, including any ranges between these values).
- the anti-E7MC construct cross-reacts with at least one (such as at least any of 2, 3, 4, 5, or 6) complex comprising the MHC class I protein and a variant of the HPV16-E7 peptide having one amino acid substitution (such as a conservative amino acid substitution).
- the anti-E7MC construct cross-reacts with at least one (such as at least any of 2, 3, 4, or 5) complex comprising the HPV16-E7 peptide and a different subtype of the MHC class I protein.
- an anti-E7MC construct comprising an anti-
- E7MC antibody moiety that specifically binds to a complex comprising an HPV16-E7 peptide and an MHC class I protein, wherein the anti-E7MC antibody moiety comprises: i) a heavy chain variable domain sequence comprising an HC-CDR1 comprising the amino acid sequence of SEQ ID NO: 183, or a variant thereof comprising up to about 3 (for example about any of 1, 2, or 3) amino acid substitutions, an HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 184 or 185, or a variant thereof comprising up to about 3 (for example about any of 1, 2, or 3) amino acid substitutions, and an HC-CDR3 comprising the amino acid sequence of any one of SEQ ID NOs: 186-188; or a variant thereof comprising up to about 3 (for example about any of 1, 2, or 3) amino acid substitutions; and ii) a light chain variable domain comprising an LC-CDR1 comprising the amino acid sequence of SEQ ID NO: 183, or
- ID NO: 191 or a variant thereof comprising up to about 3 (for example about any of 1, 2, or
- the anti-E7MC construct is non-naturally occurring. In some embodiments, the anti-E7MC construct is a full-length antibody. In some embodiments, the anti-E7MC construct is a multi- specific (such as bispecific) molecule. In some embodiments, the anti-E7MC construct is a chimeric antigen receptor. In some embodiments, the anti-E7MC construct is an immunoconjugate. In some embodiments, the anti-E7MC construct binds the E7MC with a K d between about 0.1 pM to about 500 nM
- the anti-E7MC construct cross-reacts with at least one (such as at least any of 2, 3, 4, 5, or 6) complex comprising the MHC class I protein and a variant of the HPV16-E7 peptide having one amino acid substitution (such as a conservative amino acid substitution). In some embodiments, the anti-E7MC construct cross-reacts with at least one (such as at least any of 2, 3, 4, or 5) complex comprising the HPV16-E7 peptide and a different subtype of the MHC class I protein.
- an anti-E7MC construct comprising an anti- E7MC antibody moiety that specifically binds to a complex comprising an HPV16-E7 peptide and an MHC class I protein, wherein the anti-E7MC antibody moiety comprises: i) a heavy chain variable domain sequence comprising an HC-CDR1 comprising (and in some embodiments consisting of) the amino acid sequence of any one of SEQ ID NOs: 57-77; or a variant thereof comprising up to about 5 (for example about any of 1, 2, 3, 4, or 5) amino acid substitutions; an HC-CDR2 comprising (and in some embodiments consisting of) the amino acid sequence of any one of SEQ ID NOs: 78-98; or a variant thereof comprising up to about 5 (for example about any of 1, 2, 3, 4, or 5) amino acid substitutions; and an HC-CDR3 comprising (and in some embodiments consisting of) the amino acid sequence of any one of SEQ ID NOs: 99-119
- the anti-E7MC construct is non-naturally occurring. In some embodiments, the anti-E7MC construct is a full-length antibody. In some embodiments, the anti-E7MC construct is a multi- specific (such as bispecific) molecule. In some embodiments, the anti-E7MC construct is a chimeric antigen receptor. In some embodiments, the anti-E7MC construct is an
- the anti-E7MC construct binds the E7MC with a K d between about 0.1 pM to about 500 nM (such as about any of 0.1 pM, 1.0 pM, 10 pM, 50 pM, 100 pM, 500 pM, 1 nM, 10 nM, 50 nM, 100 nM, or 500 nM, including any ranges between these values).
- the anti-E7MC construct cross-reacts with at least one (such as at least any of 2, 3, 4, 5, or 6) complex comprising the MHC class I protein and a variant of the HPV16-E7 peptide having one amino acid substitution (such as a conservative amino acid substitution).
- the anti-E7MC construct cross- reacts with at least one (such as at least any of 2, 3, 4, or 5) complex comprising the HPV16- E7 peptide and a different subtype of the MHC class I protein.
- an anti-E7MC construct comprising an anti- E7MC antibody moiety that specifically binds to a complex comprising an HPV16-E7 peptide and an MHC class I protein, wherein the anti-E7MC antibody moiety comprises: i) a heavy chain variable domain sequence comprising an HC-CDR1 comprising (and in some embodiments consisting of) the amino acid sequence of any one of SEQ ID NOs: 57-77; an HC-CDR2 comprising (and in some embodiments consisting of) the amino acid sequence of any one of SEQ ID NOs: 78-98; and an HC-CDR3 comprising (and in some embodiments consisting of) the amino acid sequence of any one of SEQ ID NOs: 99-119, 244, and 245; or a variant thereof comprising up to about 5 (for example about any of 1, 2, 3, 4, or 5) amino acid substitutions in the HC-CDR sequences; and ii) a light chain variable domain sequence comprising up to about 5 (for example about any of
- the anti-E7MC construct is non-naturally occurring. In some embodiments, the anti-E7MC construct is a full-length antibody. In some embodiments, the anti-E7MC construct is a multi- specific (such as bispecific) molecule. In some embodiments, the anti-E7MC construct is a chimeric antigen receptor. In some embodiments, the anti-E7MC construct is an immunoconjugate.
- the anti-E7MC construct binds the E7MC with a K d between about 0.1 pM to about 500 nM (such as about any of 0.1 pM, 1.0 pM, 10 pM, 50 pM, 100 pM, 500 pM, 1 nM, 10 nM, 50 nM, 100 nM, or 500 nM, including any ranges between these values).
- the anti-E7MC construct cross-reacts with at least one (such as at least any of 2, 3, 4, 5, or 6) complex comprising the MHC class I protein and a variant of the HPV16-E7 peptide having one amino acid substitution (such as a conservative amino acid substitution).
- the anti-E7MC construct cross-reacts with at least one (such as at least any of 2, 3, 4, or 5) complex comprising the HPV16-E7 peptide and a different subtype of the MHC class I protein.
- an anti-E7MC construct comprising an anti- E7MC antibody moiety that specifically binds to a complex comprising an HPV16-E7 peptide and an MHC class I protein, wherein the anti-E7MC antibody moiety comprises a heavy chain variable domain comprising (and in some embodiments consisting of) the amino acid sequence of any one of SEQ ID NOs: 15-35 and 233-237, or a variant thereof having at least about 95% (for example at least about any of 96%, 97%, 98%, or 99%) sequence identity, and a light chain variable domain comprising (and in some embodiments consisting of) the amino acid sequence of any one of SEQ ID NOs: 36-56 and 238-243, or a variant thereof having
- the anti-E7MC construct is a multi- specific (such as bispecific) molecule. In some embodiments, the anti-E7MC construct is a chimeric antigen receptor. In some embodiments, the anti-E7MC construct is an immunoconjugate. In some embodiments, the anti-E7MC construct binds the E7MC with a K d between about 0.1 pM to about 500 nM (such as about any of 0.1 pM, 1.0 pM, 10 pM, 50 pM, 100 pM, 500 pM, 1 nM, 10 nM, 50 nM, 100 nM, or 500 nM, including any ranges between these values).
- the anti-E7MC construct cross-reacts with at least one (such as at least any of 2, 3, 4, 5, or 6) complex comprising the MHC class I protein and a variant of the HPV16-E7 peptide having one amino acid substitution (such as a conservative amino acid substitution). In some embodiments, the anti-E7MC construct cross-reacts with at least one (such as at least any of 2, 3, 4, or 5) complex comprising the HPV16-E7 peptide and a different subtype of the MHC class I protein.
- an anti-E7MC construct comprising a first anti-E7MC antibody moiety that competes for binding to a target HPV16-E7/MHC class I complex with a second anti-E7MC antibody moiety according to any of the anti-E7MC antibody moieties described herein.
- the first anti-E7MC antibody moiety binds to the same, or substantially the same, epitope as the second anti-E7MC antibody moiety.
- binding of the first anti-E7MC antibody moiety to the target HPV16-E7/MHC class I complex inhibits binding of the second anti-E7MC antibody moiety to the target HPV16-E7/MHC class I complex by at least about 70% (such as by at least about any of 75%, 80%, 85%, 90%, 95%, 98% or 99%), or vice versa.
- the first anti-E7MC antibody moiety and the second anti-E7MC antibody moiety cross-compete for binding to the target HPV16-E7/MHC class I complex, i.e., each of the first and second antibody moieties competes with the other for binding to the target HPV16-E7/MHC class I complex.
- an anti-E7MC construct comprising an anti-E7MC antibody moiety that competes for binding to a target HPV16- E7/MHC class I complex with an antibody moiety comprising i) a heavy chain variable domain sequence comprising an HC-CDR1 comprising the amino acid sequence of SEQ ID NO: 183, or a variant thereof comprising up to about 3 (for example about any of 1, 2, or 3) amino acid substitutions, an HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 184 or 185, or a variant thereof comprising up to about 3 (for example about any of 1, 2, or 3) amino acid substitutions, and an HC-CDR3 comprising the amino acid sequence of any one of SEQ ID NOs: 186-188; or a variant thereof comprising up to about 3 (for example about any of 1, 2, or 3) amino acid substitutions; and ii) a light chain variable domain comprising an LC-CDR1 comprising the amino acid
- an LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 191, or a variant thereof comprising up to about 3 (for example about any of 1, 2, or 3) amino acid substitutions.
- an anti-E7MC construct comprising an anti-E7MC antibody moiety that competes for binding to a target HPV16-E7/MHC class I complex with an antibody moiety comprising i) a heavy chain variable domain sequence comprising an HC-CDR1 comprising (and in some embodiments consisting of) the amino acid sequence of any one of SEQ ID NOs: 57-77; or a variant thereof comprising up to about
- an HC-CDR2 comprising (and in some embodiments consisting of) the amino acid sequence of any one of
- HC-CDR3 comprising (and in some embodiments consisting of) the amino acid sequence of any one of SEQ ID NOs: 99-119,
- a light chain variable domain sequence comprising an LC-CDR1 comprising (and in some embodiments consisting of) the amino acid sequence of any one of SEQ ID NOs: 120-140 and 246; or a variant thereof comprising up to about 5
- an LC-CDR2 comprising (and in some embodiments consisting of) the amino acid sequence of any one of SEQ ID NOs: 141-161; or a variant thereof comprising up to about 3 (for example about any of 1, 2, or 3) amino acid substitutions; and an LC-CDR3 comprising (and in some embodiments consisting of) the amino acid sequence of any one of SEQ ID NOs: 162-182 and 247-250; or a variant thereof comprising up to about 5 (for example about any of 1, 2, 3, 4, or 5) amino acid substitutions.
- an anti-E7MC construct comprising an anti-E7MC antibody moiety that competes for binding to a target HPV16-E7/MHC class I complex with an antibody moiety comprising i) a heavy chain variable domain sequence comprising an HC-CDR1 comprising (and in some embodiments consisting of) the amino acid sequence of any one of SEQ ID NOs: 57-77; an HC-CDR2 comprising (and in some embodiments consisting of) the amino acid sequence of any one of SEQ ID NOs: 78-98; and an HC-CDR3 comprising (and in some embodiments consisting of) the amino acid sequence of any one of SEQ ID NOs: 99-119, 244, and 245; or a variant thereof comprising up to about 5 (for example about any of 1, 2, 3, 4, or 5) amino acid substitutions in the HC-CDR sequences; and ii) a light chain variable domain sequence comprising an LC-CDR1 comprising (and in some
- an anti-E7MC construct comprising an anti-E7MC antibody moiety that competes for binding to a target HPV16-E7/MHC class I complex with an antibody moiety comprising a heavy chain variable domain comprising (and in some embodiments consisting of) the amino acid sequence of any one of SEQ ID NOs: 15- 35 and 233-237, or a variant thereof having at least about 95% (for example at least about any of 96%, 97%, 98%, or 99%) sequence identity, and a light chain variable domain comprising (and in some embodiments consisting of) the amino acid sequence of any one of SEQ ID NOs: 36-56 and 238-243, or a variant thereof having at least about 95% (for example at least about any of 96%, 97%, 98%, or 99%) sequence identity.
- the anti-E7MC constructs comprise an anti-E7MC antibody moiety that specifically binds to a complex comprising an HPV16-E7 peptide and an MHC class I protein.
- the anti-E7MC antibody moiety specifically binds to an E7MC present on the surface of a cell.
- the cell is a cancer cell.
- the cancer cell is in a solid tumor.
- the cancer cell is a metastatic cancer cell.
- the HPV16-E7 peptide is an MHC class I-restricted peptide. In some embodiments, the HPV16-E7 peptide is from about 8 to about 12 (such as about any of 8, 9, 10, 11, or 12) amino acids in length.
- the HPV16-E7 peptide comprises (and in some embodiments consists of) the sequence of amino acids 7-15 of HPV16-E7 (TLHEYMLDL, SEQ ID NO: 3), amino acids 11-19 of HPV16-E7 (YMLDLQPET, SEQ ID NO: 4, also referred to herein as "HPV16-E7 11-19"), amino acids 16-25 of HPV16-E7 (QPETTDLYCY, SEQ ID NO: 5), amino acids 44-52 of HPV16-E7 (QAEPDRAHY, SEQ ID NO: 6), amino acids 46-55 of HPV16-E7 (EPDRAHYNIV, SEQ ID NO: 7), amino acids 49-57 of HPV16-E7
- RAHYNIVTF amino acids 82-90 of HPV16-E7 (LLMGTLGIV, SEQ ID NO: 9), or amino acids 86-93 of HPV16-E7 (TLGIVCPI, SEQ ID NO: 10).
- the MHC class I protein is HLA-A, HLA-B, HLA-C, HLA- E, HLA-F, or HLA-G. In some embodiments, the MHC class I protein is HLA-A. In some embodiments, the HLA-A is HLA-A02. In some embodiments, the HLA-A02 is HLA- A*02:01.
- the anti-E7MC antibody moiety is a full-length antibody.
- the anti-E7MC antibody moiety is an antigen-binding fragment, for example an antigen-binding fragment selected from the group consisting of a Fab, a Fab', a F(ab')2, an Fv fragment, a disulfide stabilized Fv fragment (dsFv), and a single-chain antibody molecule (scFv).
- the anti-E7MC antibody moiety is an scFv.
- the anti-E7MC antibody moiety is human, humanized, or semisynthetic.
- the anti-E7MC antibody moiety specifically binds to the N- terminal portion of the HPV16-E7 peptide in the complex. In some embodiments, the anti-
- E7MC antibody moiety specifically binds to the C-terminal portion of the HPV16-E7 peptide in the complex. In some embodiments, the anti-E7MC antibody moiety specifically binds to the middle portion of the HPV16-E7 peptide in the complex.
- the anti-E7MC antibody moiety (or the anti-E7MC construct comprising the anti-E7MC antibody moiety) binds to the complex comprising the HPV16-E7 peptide and the MHC class I protein with an affinity that is at least about 10 (including for example at least about any of 10, 20, 30, 40, 50, 75, 100, 200, 300, 400, 500, 750, 1000 or more) times its binding affinity for each of full-length HPV16-E7, free HPV16-E7 peptide, MHC class I protein not bound to a peptide, and MHC class I protein bound to a non-HPV16- E7 peptide.
- an affinity that is at least about 10 (including for example at least about any of 10, 20, 30, 40, 50, 75, 100, 200, 300, 400, 500, 750, 1000 or more) times its binding affinity for each of full-length HPV16-E7, free HPV16-E7 peptide, MHC class I protein not bound to a peptide, and MHC class
- the anti-E7MC antibody moiety (or the anti-E7MC construct comprising the anti-E7MC antibody moiety) binds to the complex comprising the HPV16-E7 peptide and the MHC class I protein with a K d no more than about 1/10 (such as no more than about any of 1/10, 1/20, 1/30, 1/40, 1/50, 1/75, 1/100, 1/200, 1/300, 1/400, 1/500, 1/750, 1/1000 or less) times its K d for binding to each of full-length HPV16-E7, free HPV16-E7 peptide, MHC class I protein not bound to a peptide, and MHC class I protein bound to a non-HPV16-E7 peptide.
- a K d no more than about 1/10 such as no more than about any of 1/10, 1/20, 1/30, 1/40, 1/50, 1/75, 1/100, 1/200, 1/300, 1/400, 1/500, 1/750, 1/
- the anti-E7MC antibody moiety (or the anti-E7MC construct comprising the anti-E7MC antibody moiety) binds to the complex comprising the HPV16-E7 peptide and the MHC class I protein with a K d between about 0.1 pM to about 500 nM (such as about any of 0.1 pM, 1.0 pM, 10 pM, 50 pM, 100 pM, 500 pM, 1 nM, 10 nM, 50 nM, 100 nM, or 500 nM, including any ranges between these values).
- the anti-E7MC antibody moiety binds to the complex comprising the HPV16-E7 peptide and the MHC class I protein with a K d between about 0.1 pM to about 500 nM (such as about any of 0.1 pM, 1.0 pM, 10 pM, 50 pM, 100 pM, 500 pM, 1 nM, 10 nM, 50 nM,
- E7MC antibody moiety (or the anti-E7MC construct comprising the anti-E7MC antibody moiety) binds to the complex comprising the HPV16-E7 peptide and the MHC class I protein with a K d between about 1 pM to about 250 pM (such as about any of 1, 10, 25, 50, 75, 100,
- the anti-E7MC antibody moiety (or the anti-E7MC construct comprising the anti-E7MC antibody moiety) binds to the complex comprising the HPV16-E7 peptide and the MHC class I protein with a K d between about 1 nM to about 500 nM (such as about any of 1, 10, 25, 50, 75, 100,
- the anti-E7MC antibody moiety specifically binds to a complex comprising an HPV16-E7 peptide and an MHC class I protein, wherein the anti-
- E7MC antibody moiety cross-reacts with at least one complex comprising the HPV16-E7 peptide and an allelic variant of the MHC class I protein.
- the allelic variant has up to about 10 (such as about any of 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10) amino acid substitutions when compared to the MHC class I protein.
- the allelic variant is the same serotype as the MHC class I protein.
- the allelic variant is a different serotype than the MHC class I protein.
- the anti- E7MC antibody moiety does not cross-react with any complex comprising the HPV16-E7 peptide and an allelic variant of the MHC class I protein.
- the anti- E7MC antibody moiety cross-reacts with at least one (such as at least any of 2, 3, 4, or 5) complex comprising the HPV16-E7 peptide and a different subtype of the MHC class I protein.
- the anti-E7MC antibody moiety specifically binds to a complex comprising an HPV16-E7 peptide and an MHC class I protein, wherein the anti- E7MC antibody moiety cross-reacts with at least one complex comprising the MHC class I protein and a variant of the HPV16-E7 peptide having one amino acid substitution (such as a conservative amino acid substitution). In some embodiments, the anti-E7MC antibody moiety does not cross-react with any complex comprising the MHC class I protein and a variant of the HPV16-E7 peptide.
- the anti-E7MC antibody moiety specifically binds to a complex comprising HPV16-E7 11-19 (SEQ ID NO: 4) and an MHC class I protein (such as HLA-A02, for example HLA-A*02:01).
- the anti- E7MC antibody moiety further binds to at least one (including at least about any of 2 or 3) of: a complex comprising an alanine-substituted HPV16-E7 peptide of SEQ ID NO: 12 and an MHC class I protein (such as HLA-A02, for example HLA-A*02:01); a complex comprising an alanine-substituted HPV16-E7 peptide of SEQ ID NO: 13 and an MHC class I protein (such as HLA-A02, for example HLA-A*02:01); and a complex comprising an alanine- substituted HPV16-E7 peptide of SEQ ID NO: 14 and an MHC class I protein (such as HLA- A02, for example HLA-A*02:01).
- a complex comprising an alanine-substituted HPV16-E7 peptide of SEQ ID NO: 12 and an MHC class I protein such as HLA-A02,
- the anti-E7MC antibody moiety specifically binds to: a complex comprising an HPV16-E7 peptide of SEQ ID NO: 4 and an MHC class I protein (such as HLA-A02, for example HLA-A*02:01); a complex comprising an alanine- substituted HPV16-E7 peptide of SEQ ID NO: 12 and an MHC class I protein (such as HLA- A02, for example HLA-A*02:01); and a complex comprising an alanine-substituted HPV16- E7 peptide of SEQ ID NO: 13 and an MHC class I protein (such as HLA-A02, for example HLA-A*02:01).
- the anti-E7MC antibody moiety specifically binds to: a complex comprising an HPV16-E7 peptide of SEQ ID NO: 4 and an MHC class I protein (such as HLA-A02, for example HLA-A*02:01); a complex comprising an alanine- substituted HPV16-E7 peptide of SEQ ID NO: 12 and an MHC class I protein (such as HLA- A02, for example HLA-A*02:01); and a complex comprising an alanine-substituted HPV16- E7 peptide of SEQ ID NO: 14 and an MHC class I protein (such as HLA-A02, for example HLA-A*02:01).
- the anti-E7MC antibody moiety specifically binds to: a complex comprising an HPV16-E7 peptide of SEQ ID NO: 4 and an MHC class I protein (such as HLA-A02, for example HLA-A*02:01); and a complex comprising an alanine- substituted HPV16-E7 peptide of SEQ ID NO: 12 and an MHC class I protein (such as HLA- A02, for example HLA-A*02:01).
- the anti-E7MC antibody moiety specifically binds to: a complex comprising an HPV16-E7 peptide of SEQ ID NO: 4 and an MHC class I protein (such as HLA-A02, for example HLA-A*02:01); and a complex comprising an alanine- substituted HPV16-E7 peptide of SEQ ID NO: 14 and an MHC class I protein (such as HLA- A02, for example HLA-A*02:01).
- the anti-E7MC antibody moiety specifically binds to a complex comprising HPV16-E7 11-19 (SEQ ID NO: 4) and HLA-A*02:01.
- the anti-E7MC antibody moiety cross-reacts with at least one (including at least about any of 2, 3, 4, 5, or 6) of: a complex comprising HPV16-E7 11-19 (SEQ ID NO: 4) and HLA-A*02:02 (GenBank Accession No.: AFL91480), a complex comprising HPV16- E7 11-19 (SEQ ID NO: 4) and HLA-A*02:03 (GenBank Accession No.: AAA03604), a complex comprising HPV16-E7 11-19 (SEQ ID NO: 4) and HLA-A*02:05 (GenBank Accession No.: AAA03603), a complex comprising HPV16-E7 11-19 (SEQ ID NO: 4) and HLA-A*02:06 (GenBank Accession No.: 4)
- the anti-E7MC antibody moiety specifically binds to: a complex comprising HPV16-E7 11-19 (SEQ ID NO: 4) and an MHC class I protein (such as HLA-A02, for example HLA-A*02:01); and a complex comprising an HPV16-E7 11-19 variant having the amino acid sequence of YMLDVQPET (SEQ ID NO: 11) and an MHC class I protein (such as HLA-A02, for example HLA-A*02:01).
- the anti-E7MC antibody moiety is a semi-synthetic antibody moiety comprising fully human sequences and one or more synthetic regions. In some embodiments, the anti-E7MC antibody moiety is a semi-synthetic antibody moiety comprising a fully human light chain variable domain and a semi-synthetic heavy chain variable domain comprising fully human FR1, HC-CDR1, FR2, HC-CDR2, FR3, and FR4 regions and a synthetic HC-CDR3.
- the semi- synthetic heavy chain variable domain comprises a fully synthetic HC-CDR3 having a sequence from about 5 to about 25 (such as about any of 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, or 25) amino acids in length.
- the semi-synthetic heavy chain variable domain or the synthetic HC-CDR3 is obtained from a semi-synthetic library (such as a semi-synthetic human library) comprising fully synthetic HC-CDR3s having a sequence from about 5 to about 25 (such as about any of 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, or 25) amino acids in length, wherein each amino acid in the sequence is randomly selected from the standard human amino acids, minus cysteine.
- the synthetic HC-CDR3 is from about 7 to about 15 (such as about any of 7, 8, 9, 10, 11, 12, 13, 14, or 15) amino acids in length.
- the anti-E7MC antibody moieties in some embodiments comprise specific sequences or certain variants of such sequences.
- the amino acid substitutions in the variant sequences do not substantially reduce the ability of the anti-E7MC antibody moiety to bind the E7MC.
- alterations that do not substantially reduce E7MC binding affinity may be made.
- Alterations that substantially improve E7MC binding affinity or affect some other property, such as specificity and/or cross -reactivity with related variants of the E7MC, are also contemplated.
- the anti-E7MC antibody moiety comprises i) a heavy chain variable domain comprising an HC-CDR3 comprising the amino acid sequence of any one of
- SEQ ID NOs: 186-188 or a variant thereof comprising up to about 3 (for example about any of 1, 2, or 3) amino acid substitutions; and ii) a light chain variable domain comprising an
- LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 191, or a variant thereof comprising up to about 3 (for example about any of 1, 2, or 3) amino acid substitutions.
- the anti-E7MC antibody moiety comprises i) a heavy chain variable domain comprising an HC-CDR3 comprising the amino acid sequence of any one of SEQ ID NOs: 186-188; and ii) a light chain variable domain comprising an LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 191.
- the anti-E7MC antibody moiety comprises i) a heavy chain variable domain comprising an HC-CDR1 comprising the amino acid sequence of SEQ ID NO: 183, or a variant thereof comprising up to about 3 (for example about any of 1, 2, or 3) amino acid substitutions, an HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 184 or 185, or a variant thereof comprising up to about 3 (for example about any of 1, 2, or 3) amino acid substitutions, and an HC-CDR3 comprising the amino acid sequence of any one of SEQ ID NOs: 186-188, or a variant thereof comprising up to about 3 (for example about any of 1, 2, or 3) amino acid substitutions; and ii) a light chain variable domain comprising an LC-CDRl comprising the amino acid sequence of SEQ ID NO: 189 or 190, or a variant thereof comprising up to about 3 (for example about any of 1, 2, or 3) amino acid substitutions; and ii) a light chain variable domain
- an LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 191, or a variant thereof comprising up to about 3 (for example about any of 1, 2, or 3) amino acid substitutions.
- the anti-E7MC antibody moiety comprises i) a heavy chain variable domain comprising an HC-CDR1 comprising the amino acid sequence of SEQ ID NO: 1
- an HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 183, or a variant thereof comprising up to about 3 (for example about any of 1, 2, or 3) amino acid substitutions, an HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 183, or a variant thereof comprising up to about 3 (for example about any of 1, 2, or 3) amino acid substitutions, an HC-CDR2 comprising the amino acid sequence of SEQ ID NO:
- a variant thereof comprising up to about 3 (for example about any of 1, 2, or 3) amino acid substitutions, and an HC-CDR3 comprising the amino acid sequence of any one of SEQ ID NOs: 186-188; and ii) a light chain variable domain comprising an LC-CDRl comprising the amino acid sequence of SEQ ID NO: 189 or 190, or a variant thereof comprising up to about 3 (for example about any of 1, 2, or 3) amino acid substitutions, and an LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 191.
- the anti-E7MC antibody moiety comprises i) a heavy chain variable domain comprising an HC-CDR1 comprising the amino acid sequence of SEQ ID NO: 1
- an HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 184 or 185
- an HC-CDR3 comprising the amino acid sequence of any one of SEQ ID NOs: 186-188; or a variant thereof comprising up to about 3 (such as about any of 1, 2, or 3) amino acid substitutions in the HC-CDR sequences; and ii) a light chain variable domain comprising an
- LC-CDRl comprising the amino acid sequence of SEQ ID NO: 189 or 190, and an LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 191; or a variant thereof comprising up to about 3 (such as about any of 1, 2, or 3) amino acid substitutions in the LC-CDR sequences.
- the anti-E7MC antibody moiety comprises i) a heavy chain variable domain comprising an HC-CDR1 comprising the amino acid sequence of SEQ ID NO: 183, an HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 184 or 185, and an HC-CDR3 comprising the amino acid sequence of any one of SEQ ID NOs: 186-188; and ii) a light chain variable domain comprising an LC-CDR 1 comprising the amino acid sequence of SEQ ID NO: 189 or 190, and an LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 191.
- the sequences of the CDRs noted herein are provided in Table 2 below.
- the anti-E7MC antibody moiety comprises i) a heavy chain variable domain comprising an HC-CDR3 comprising the amino acid sequence of any one of SEQ ID NOs: 99-119, 244, and 245, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions; and ii) a light chain variable domain comprising an LC-CDR3 comprising the amino acid sequence of any one of SEQ ID NOs: 162-182 and 247-250, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions.
- the anti-E7MC antibody moiety comprises i) a heavy chain variable domain comprising an HC-CDR3 comprising the amino acid sequence of any one of SEQ ID NOs: 99-119, 244, and 245; and ii) a light chain variable domain comprising an LC- CDR3 comprising the amino acid sequence of any one of SEQ ID NOs: 162-182 and 247- 250.
- the anti-E7MC antibody moiety comprises i) a heavy chain variable domain comprising an HC-CDRl comprising the amino acid sequence of any one of SEQ ID NOs: 57-77, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions, an HC-CDR2 comprising the amino acid sequence of any one of SEQ ID NOs: 78-98, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions, and an HC-CDR3 comprising the amino acid sequence of any one of SEQ ID NOs: 99-119, 244, and 245, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions; and ii) a light chain variable domain comprising an LC-CDR1 comprising the amino acid sequence of any one of SEQ ID NOs: 120-140 and 246, or a variant thereof comprising
- the anti-E7MC antibody moiety comprises i) a heavy chain variable domain comprising an HC-CDRl comprising the amino acid sequence of any one of SEQ ID NOs: 57-77, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions, an HC-CDR2 comprising the amino acid sequence of any one of SEQ ID NOs: 78-98, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions, and an HC-CDR3 comprising the amino acid sequence of any one of SEQ ID NOs: 99-119, 244, and 245; and ii) a light chain variable domain comprising an LC-CDR1 comprising the amino acid sequence of any one of SEQ ID NOs: 120-140 and 246, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions, an LC-CDR
- the anti-E7MC antibody moiety comprises i) a heavy chain variable domain sequence comprising an HC-CDR 1 comprising the amino acid sequence of any one of SEQ ID NOs: 57-77; an HC-CDR2 comprising the amino acid sequence of any one of SEQ ID NOs: 78-98; and an HC-CDR3 comprising the amino acid sequence of any one of SEQ ID NOs: 99-119, 244, and 245; or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions in the HC-CDR sequences; and ii) a light chain variable domain sequence comprising an LC-CDR1 comprising the amino acid sequence of any one of SEQ ID NOs: 120-140 and 246; an LC-CDR2 comprising the amino acid sequence of any one of SEQ ID NOs: 141-161; and an LC-CDR3 comprising the amino acid sequence of any one of SEQ ID NOs:
- the anti-E7MC antibody moiety comprises i) a heavy chain variable domain sequence comprising an HC-CDR 1 comprising the amino acid sequence of any one of SEQ ID NOs: 57-77; an HC-CDR2 comprising the amino acid sequence of any one of SEQ ID NOs: 78-98; and an HC-CDR3 comprising the amino acid sequence of any one of SEQ ID NOs: 99-119, 244, and 245; or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions, wherein the amino acid substitutions are in HC-CDR1 or HC-CDR2; and ii) a light chain variable domain sequence comprising an LC-CDR 1 comprising the amino acid sequence of any one of SEQ ID NOs: 120-140 and 246; an LC-CDR2 comprising the amino acid sequence of any one of SEQ ID NOs: 141-161; and an LC-CDR3 comprising
- the anti-E7MC antibody moiety comprises i) a heavy chain variable domain sequence comprising an HC-CDR 1 comprising the amino acid sequence of any one of SEQ ID NOs: 57-77; an HC-CDR2 comprising the amino acid sequence of any one of SEQ ID NOs: 78-98; and an HC-CDR3 comprising the amino acid sequence of any one of SEQ ID NOs: 99-119, 244, and 245; and ii) a light chain variable domain sequence comprising an LC-CDR 1 comprising the amino acid sequence of any one of SEQ ID NOs: 120-140 and 246; an LC-CDR2 comprising the amino acid sequence of any one of SEQ ID NOs: 141-161; and an LC-CDR3 comprising the amino acid sequence of any one of SEQ ID NOs: 162-182 and 247-250.
- the sequences of the HC-CDRs noted herein are provided in Table 3 below and the LC-CDRs noted
- SEQ ID NO: 64 SEQ ID NO: 85 SEQ ID NO: 106
- LC-CDR1 40 SSNIGSNH LC-CDR2 40 NNN LC-CDR3 40 AAWDDSLNVPV
- LC-CDR1 41 TLRSFY LC-CDR2 41 GKN LC-CDR3 41 NSRDSGGDPVV
- the anti-E7MC antibody moiety comprises a heavy chain variable domain comprising the amino acid sequence of any one of SEQ ID NOs: 15-35 and 233-237, or a variant thereof having at least about 95% (including for example at least about any of 96%, 97%, 98%, or 99%) sequence identity, and a light chain variable domain comprising the amino acid sequence of any one of SEQ ID NOs: 36-56 and 238-243, or a variant thereof having at least about 95% (including for example at least any of 96%, 97%, 98%, or 99%) sequence identity.
- the anti-E7MC antibody moiety comprises a heavy chain variable domain comprising the amino acid sequence of any one of SEQ ID NOs: 15-35 and 233-237 and a light chain variable domain comprising the amino acid sequence of any one of SEQ ID NOs: 36-56 and 238-243.
- the heavy and light chain variable domains can be combined in various pair- wise combinations to generate a number of anti-E7MC antibody moieties.
- the anti-E7MC antibody moiety comprises a heavy chain variable domain comprising an HC-CDR1 comprising the amino acid sequence of SEQ ID NO: 57, or a variant thereof comprising up to about 5 (for example about any of 1,
- an HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 78, or a variant thereof comprising up to about 5 (for example about any of 1, 2,
- an HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 99, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions; and a light chain variable domain comprising an LC-CDR1 comprising the amino acid sequence of SEQ ID NO: 120, or a variant thereof comprising up to about 5 (for example about any of 1, 2, 3, 4, or 5) amino acid substitutions; an LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 141, or a variant thereof comprising up to about 3 (for example about any of 1, 2, or 3) amino acid substitutions; and an LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 162, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions.
- the anti-E7MC antibody moiety comprises a heavy chain variable domain comprising an HC-CDR1 comprising the amino acid sequence of SEQ ID NO: 57, an HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 78, and an HC- CDR3 comprising the amino acid sequence of SEQ ID NO: 99, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions in the HC-CDR sequences; and a light chain variable domain comprising an LC-CDR1 comprising the amino acid sequence of SEQ ID NO: 120, an LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 141, and an LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 162, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions in the LC-CDR sequences.
- the anti-E7MC antibody moiety comprises a heavy chain variable domain comprising an HC-CDR 1 comprising the amino acid sequence of SEQ ID NO: 57, an HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 78, and an HC- CDR3 comprising the amino acid sequence of SEQ ID NO: 99; and a light chain variable domain comprising an LC-CDR1 comprising the amino acid sequence of SEQ ID NO: 120, an LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 141, and an LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 162.
- the anti-E7MC antibody moiety comprises a heavy chain variable domain comprising an HC-CDR 1 comprising the amino acid sequence of SEQ ID NO: 1
- NO: 58 or a variant thereof comprising up to about 5 (for example about any of 1, 2, 3, 4, or
- NO: 79 or a variant thereof comprising up to about 5 (for example about any of 1, 2, 3, 4, or
- ID NO: 100 or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or
- amino acid substitutions and a light chain variable domain comprising an LC-CDR1 comprising the amino acid sequence of SEQ ID NO: 121, or a variant thereof comprising up to about 5 (for example about any of 1, 2, 3, 4, or 5) amino acid substitutions; an LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 142, or a variant thereof comprising up to about 3 (for example about any of 1, 2, or 3) amino acid substitutions; and an LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 163, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions.
- the anti-E7MC antibody moiety comprises a heavy chain variable domain comprising an HC-CDR 1 comprising the amino acid sequence of SEQ ID NO: 58, an HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 79, and an HC- CDR3 comprising the amino acid sequence of SEQ ID NO: 100, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions in the HC-CDR sequences; and a light chain variable domain comprising an LC-CDRl comprising the amino acid sequence of SEQ ID NO: 121, an LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 142, and an LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 163, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions in the LC-CDR sequences.
- the anti-E7MC antibody moiety comprises a heavy chain variable domain comprising an HC-CDR 1 comprising the amino acid sequence of SEQ ID NO: 58, an HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 79, and an HC- CDR3 comprising the amino acid sequence of SEQ ID NO: 100; and a light chain variable domain comprising an LC-CDRl comprising the amino acid sequence of SEQ ID NO: 121, an LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 142, and an LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 163.
- the anti-E7MC antibody moiety comprises a heavy chain variable domain comprising an HC-CDR 1 comprising the amino acid sequence of SEQ ID NO: 1
- NO: 59 or a variant thereof comprising up to about 5 (for example about any of 1, 2, 3, 4, or
- NO: 80 or a variant thereof comprising up to about 5 (for example about any of 1, 2, 3, 4, or
- ID NO: 101 or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or
- amino acid substitutions and a light chain variable domain comprising an LC-CDRl comprising the amino acid sequence of SEQ ID NO: 122, or a variant thereof comprising up to about 5 (for example about any of 1, 2, 3, 4, or 5) amino acid substitutions; an LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 143, or a variant thereof comprising up to about 3 (for example about any of 1, 2, or 3) amino acid substitutions; and an LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 164, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions.
- the anti-E7MC antibody moiety comprises a heavy chain variable domain comprising an HC-CDR 1 comprising the amino acid sequence of SEQ ID NO: 59, an HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 80, and an HC- CDR3 comprising the amino acid sequence of SEQ ID NO: 101, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions in the HC-CDR sequences; and a light chain variable domain comprising an LC-CDRl comprising the amino acid sequence of SEQ ID NO: 122, an LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 143, and an LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 164, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions in the LC-CDR sequences.
- the anti-E7MC antibody moiety comprises a heavy chain variable domain comprising an HC-CDR 1 comprising the amino acid sequence of SEQ ID NO: 59, an HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 80, and an HC- CDR3 comprising the amino acid sequence of SEQ ID NO: 101; and a light chain variable domain comprising an LC-CDRl comprising the amino acid sequence of SEQ ID NO: 122, an LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 143, and an LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 164.
- the anti-E7MC antibody moiety comprises a heavy chain variable domain comprising an HC-CDR 1 comprising the amino acid sequence of SEQ ID NO: 1
- NO: 60 or a variant thereof comprising up to about 5 (for example about any of 1, 2, 3, 4, or
- NO: 81 or a variant thereof comprising up to about 5 (for example about any of 1, 2, 3, 4, or
- ID NO: 102 or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or
- amino acid substitutions and a light chain variable domain comprising an LC-CDRl comprising the amino acid sequence of SEQ ID NO: 123, or a variant thereof comprising up to about 5 (for example about any of 1, 2, 3, 4, or 5) amino acid substitutions; an LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 144, or a variant thereof comprising up to about 3 (for example about any of 1, 2, or 3) amino acid substitutions; and an LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 165, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions.
- the anti-E7MC antibody moiety comprises a heavy chain variable domain comprising an HC-CDR 1 comprising the amino acid sequence of SEQ ID NO: 60, an HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 81, and an HC- CDR3 comprising the amino acid sequence of SEQ ID NO: 102, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions in the HC-CDR sequences; and a light chain variable domain comprising an LC-CDRl comprising the amino acid sequence of SEQ ID NO: 123, an LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 144, and an LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 165, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions in the LC-CDR sequences.
- the anti-E7MC antibody moiety comprises a heavy chain variable domain comprising an HC-CDR 1 comprising the amino acid sequence of SEQ ID NO: 60, an HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 81, and an HC- CDR3 comprising the amino acid sequence of SEQ ID NO: 102; and a light chain variable domain comprising an LC-CDRl comprising the amino acid sequence of SEQ ID NO: 123, an LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 144, and an LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 165.
- the anti-E7MC antibody moiety comprises a heavy chain variable domain comprising an HC-CDR 1 comprising the amino acid sequence of SEQ ID NO: 1
- NO: 61 or a variant thereof comprising up to about 5 (for example about any of 1, 2, 3, 4, or
- NO: 82 or a variant thereof comprising up to about 5 (for example about any of 1, 2, 3, 4, or
- ID NO: 103 or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or
- amino acid substitutions and a light chain variable domain comprising an LC-CDRl comprising the amino acid sequence of SEQ ID NO: 124, or a variant thereof comprising up to about 5 (for example about any of 1, 2, 3, 4, or 5) amino acid substitutions; an LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 145, or a variant thereof comprising up to about 3 (for example about any of 1, 2, or 3) amino acid substitutions; and an LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 166, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions.
- the anti-E7MC antibody moiety comprises a heavy chain variable domain comprising an HC-CDR 1 comprising the amino acid sequence of SEQ ID NO: 61, an HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 82, and an HC- CDR3 comprising the amino acid sequence of SEQ ID NO: 103, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions in the HC-CDR sequences; and a light chain variable domain comprising an LC-CDRl comprising the amino acid sequence of SEQ ID NO: 124, an LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 145, and an LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 166, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions in the LC-CDR sequences.
- the anti-E7MC antibody moiety comprises a heavy chain variable domain comprising an HC-CDR 1 comprising the amino acid sequence of SEQ ID NO: 61, an HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 82, and an HC- CDR3 comprising the amino acid sequence of SEQ ID NO: 103; and a light chain variable domain comprising an LC-CDRl comprising the amino acid sequence of SEQ ID NO: 124, an LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 145, and an LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 166.
- the anti-E7MC antibody moiety comprises a heavy chain variable domain comprising an HC-CDR 1 comprising the amino acid sequence of SEQ ID NO: 1
- NO: 62 or a variant thereof comprising up to about 5 (for example about any of 1, 2, 3, 4, or
- NO: 83 or a variant thereof comprising up to about 5 (for example about any of 1, 2, 3, 4, or
- ID NO: 104 or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or
- amino acid substitutions and a light chain variable domain comprising an LC-CDRl comprising the amino acid sequence of SEQ ID NO: 125, or a variant thereof comprising up to about 5 (for example about any of 1, 2, 3, 4, or 5) amino acid substitutions; an LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 146, or a variant thereof comprising up to about 3 (for example about any of 1, 2, or 3) amino acid substitutions; and an LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 167, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions.
- the anti-E7MC antibody moiety comprises a heavy chain variable domain comprising an HC-CDR 1 comprising the amino acid sequence of SEQ ID NO: 62, an HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 83, and an HC- CDR3 comprising the amino acid sequence of SEQ ID NO: 104, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions in the HC-CDR sequences; and a light chain variable domain comprising an LC-CDRl comprising the amino acid sequence of SEQ ID NO: 125, an LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 146, and an LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 167, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions in the LC-CDR sequences.
- the anti-E7MC antibody moiety comprises a heavy chain variable domain comprising an HC-CDR 1 comprising the amino acid sequence of SEQ ID NO: 62, an HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 83, and an HC- CDR3 comprising the amino acid sequence of SEQ ID NO: 104; and a light chain variable domain comprising an LC-CDRl comprising the amino acid sequence of SEQ ID NO: 125, an LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 146, and an LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 167.
- the anti-E7MC antibody moiety comprises a heavy chain variable domain comprising an HC-CDR 1 comprising the amino acid sequence of SEQ ID NO: 1
- NO: 63 or a variant thereof comprising up to about 5 (for example about any of 1, 2, 3, 4, or
- NO: 84 or a variant thereof comprising up to about 5 (for example about any of 1, 2, 3, 4, or
- ID NO: 105 or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or
- amino acid substitutions and a light chain variable domain comprising an LC-CDRl comprising the amino acid sequence of SEQ ID NO: 126, or a variant thereof comprising up to about 5 (for example about any of 1, 2, 3, 4, or 5) amino acid substitutions; an LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 147, or a variant thereof comprising up to about 3 (for example about any of 1, 2, or 3) amino acid substitutions; and an LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 168, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions.
- the anti-E7MC antibody moiety comprises a heavy chain variable domain comprising an HC-CDR 1 comprising the amino acid sequence of SEQ ID NO: 1
- an HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 84, and an HC-
- CDR3 comprising the amino acid sequence of SEQ ID NO: 105, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions in the HC-CDR sequences; and a light chain variable domain comprising an LC-CDR1 comprising the amino acid sequence of SEQ ID NO: 126, an LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 147, and an LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 168, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions in the LC-CDR sequences.
- the anti-E7MC antibody moiety comprises a heavy chain variable domain comprising an HC-CDR 1 comprising the amino acid sequence of SEQ ID NO: 63, an HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 84, and an HC- CDR3 comprising the amino acid sequence of SEQ ID NO: 105; and a light chain variable domain comprising an LC-CDR1 comprising the amino acid sequence of SEQ ID NO: 126, an LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 147, and an LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 168.
- the anti-E7MC antibody moiety comprises a heavy chain variable domain comprising an HC-CDR 1 comprising the amino acid sequence of SEQ ID NO: 1
- NO: 64 or a variant thereof comprising up to about 5 (for example about any of 1, 2, 3, 4, or
- NO: 85 or a variant thereof comprising up to about 5 (for example about any of 1, 2, 3, 4, or
- ID NO: 106 or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or
- amino acid substitutions and a light chain variable domain comprising an LC-CDR1 comprising the amino acid sequence of SEQ ID NO: 127, or a variant thereof comprising up to about 5 (for example about any of 1, 2, 3, 4, or 5) amino acid substitutions; an LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 148, or a variant thereof comprising up to about 3 (for example about any of 1, 2, or 3) amino acid substitutions; and an LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 169, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions.
- the anti-E7MC antibody moiety comprises a heavy chain variable domain comprising an HC-CDR 1 comprising the amino acid sequence of SEQ ID NO: 1
- an HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 85, and an HC-
- CDR3 comprising the amino acid sequence of SEQ ID NO: 106, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions in the
- HC-CDR sequences comprising an LC-CDR1 comprising the amino acid sequence of SEQ ID NO: 127, an LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 148, and an LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 169, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions in the LC-CDR sequences.
- the anti-E7MC antibody moiety comprises a heavy chain variable domain comprising an HC-CDR1 comprising the amino acid sequence of SEQ ID NO: 64, an HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 85, and an HC- CDR3 comprising the amino acid sequence of SEQ ID NO: 106; and a light chain variable domain comprising an LC-CDR1 comprising the amino acid sequence of SEQ ID NO: 127, an LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 148, and an LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 169.
- the anti-E7MC antibody moiety comprises a heavy chain variable domain comprising an HC-CDR1 comprising the amino acid sequence of SEQ ID NO: 1
- NO: 65 or a variant thereof comprising up to about 5 (for example about any of 1, 2, 3, 4, or
- NO: 86 or a variant thereof comprising up to about 5 (for example about any of 1, 2, 3, 4, or
- ID NO: 107 or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or
- amino acid substitutions and a light chain variable domain comprising an LC-CDR1 comprising the amino acid sequence of SEQ ID NO: 128, or a variant thereof comprising up to about 5 (for example about any of 1, 2, 3, 4, or 5) amino acid substitutions; an LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 149, or a variant thereof comprising up to about 3 (for example about any of 1, 2, or 3) amino acid substitutions; and an LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 170, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions.
- the anti-E7MC antibody moiety comprises a heavy chain variable domain comprising an HC-CDR1 comprising the amino acid sequence of SEQ ID NO: 1
- an HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 86, and an HC-
- CDR3 comprising the amino acid sequence of SEQ ID NO: 107, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions in the
- HC-CDR sequences comprising an LC-CDR1 comprising the amino acid sequence of SEQ ID NO: 128, an LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 149, and an LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 170, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions in the LC-CDR sequences.
- the anti-E7MC antibody moiety comprises a heavy chain variable domain comprising an HC-CDR 1 comprising the amino acid sequence of SEQ ID NO: 65, an HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 86, and an HC- CDR3 comprising the amino acid sequence of SEQ ID NO: 107; and a light chain variable domain comprising an LC-CDRl comprising the amino acid sequence of SEQ ID NO: 128, an LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 149, and an LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 170.
- the anti-E7MC antibody moiety comprises a heavy chain variable domain comprising an HC-CDR 1 comprising the amino acid sequence of SEQ ID NO: 1
- NO: 66 or a variant thereof comprising up to about 5 (for example about any of 1, 2, 3, 4, or
- NO: 87 or a variant thereof comprising up to about 5 (for example about any of 1, 2, 3, 4, or
- ID NO: 108 or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or
- amino acid substitutions and a light chain variable domain comprising an LC-CDRl comprising the amino acid sequence of SEQ ID NO: 129, or a variant thereof comprising up to about 5 (for example about any of 1, 2, 3, 4, or 5) amino acid substitutions; an LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 150, or a variant thereof comprising up to about 3 (for example about any of 1, 2, or 3) amino acid substitutions; and an LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 171, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions.
- the anti-E7MC antibody moiety comprises a heavy chain variable domain comprising an HC-CDR 1 comprising the amino acid sequence of SEQ ID NO: 1
- an HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 87, and an HC-
- CDR3 comprising the amino acid sequence of SEQ ID NO: 108, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions in the
- HC-CDR sequences comprising an LC-CDRl comprising the amino acid sequence of SEQ ID NO: 129, an LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 150, and an LC-CDR3 comprising the amino acid sequence of SEQ
- ID NO: 171 or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or
- the anti-E7MC antibody moiety comprises a heavy chain variable domain comprising an HC-CDR 1 comprising the amino acid sequence of SEQ ID NO: 66, an HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 87, and an HC- CDR3 comprising the amino acid sequence of SEQ ID NO: 108; and a light chain variable domain comprising an LC-CDRl comprising the amino acid sequence of SEQ ID NO: 129, an LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 150, and an LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 171.
- the anti-E7MC antibody moiety comprises a heavy chain variable domain comprising an HC-CDR 1 comprising the amino acid sequence of SEQ ID NO: 67, or a variant thereof comprising up to about 5 (for example about any of 1, 2, 3, 4, or 5) amino acid substitutions; an HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 88, or a variant thereof comprising up to about 5 (for example about any of 1, 2, 3, 4, or 5) amino acid substitutions; and an HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 109, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions; and a light chain variable domain comprising an LC-CDRl comprising the amino acid sequence of SEQ ID NO: 130, or a variant thereof comprising up to about 5 (for example about any of 1, 2, 3, 4, or 5) amino acid substitutions; an LC-CDR2 comprising the amino acid sequence of S
- the anti-E7MC antibody moiety comprises a heavy chain variable domain comprising an HC-CDR 1 comprising the amino acid sequence of SEQ ID NO: 67, an HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 88, and an HC- CDR3 comprising the amino acid sequence of SEQ ID NO: 109, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions in the HC-CDR sequences; and a light chain variable domain comprising an LC-CDRl comprising the amino acid sequence of SEQ ID NO: 130, an LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 151, and an LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 172, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions in the LC-CDR sequences.
- the anti-E7MC antibody moiety comprises a heavy chain variable domain comprising an HC-CDR 1 comprising the amino acid sequence of SEQ ID NO: 67, an HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 88, and an HC- CDR3 comprising the amino acid sequence of SEQ ID NO: 109; and a light chain variable domain comprising an LC-CDRl comprising the amino acid sequence of SEQ ID NO: 130, an LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 151, and an LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 172.
- the anti-E7MC antibody moiety comprises a heavy chain variable domain comprising an HC-CDR 1 comprising the amino acid sequence of SEQ ID NO: 68, or a variant thereof comprising up to about 5 (for example about any of 1, 2, 3, 4, or 5) amino acid substitutions; an HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 89, or a variant thereof comprising up to about 5 (for example about any of 1, 2, 3, 4, or 5) amino acid substitutions; and an HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 110, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions; and a light chain variable domain comprising an LC-CDRl comprising the amino acid sequence of SEQ ID NO: 131, or a variant thereof comprising up to about 5 (for example about any of 1, 2, 3, 4, or 5) amino acid substitutions; an LC-CDR2 comprising the amino acid sequence of S
- the anti-E7MC antibody moiety comprises a heavy chain variable domain comprising an HC-CDR 1 comprising the amino acid sequence of SEQ ID NO: 68, an HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 89, and an HC- CDR3 comprising the amino acid sequence of SEQ ID NO: 110, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions in the HC-CDR sequences; and a light chain variable domain comprising an LC-CDRl comprising the amino acid sequence of SEQ ID NO: 131, an LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 152, and an LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 173, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions in the LC-CDR sequences.
- the anti-E7MC antibody moiety comprises a heavy chain variable domain comprising an HC-CDR 1 comprising the amino acid sequence of SEQ ID NO: 1
- an HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 89, and an HC-
- CDR3 comprising the amino acid sequence of SEQ ID NO: 110; and a light chain variable domain comprising an LC-CDRl comprising the amino acid sequence of SEQ ID NO: 131, an LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 152, and an LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 173.
- the anti-E7MC antibody moiety comprises a heavy chain variable domain comprising an HC-CDR 1 comprising the amino acid sequence of SEQ ID NO: 69, or a variant thereof comprising up to about 5 (for example about any of 1, 2, 3, 4, or 5) amino acid substitutions; an HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 90, or a variant thereof comprising up to about 5 (for example about any of 1, 2, 3, 4, or 5) amino acid substitutions; and an HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 111, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions; and a light chain variable domain comprising an LC-CDRl comprising the amino acid sequence of SEQ ID NO: 132, or a variant thereof comprising up to about 5 (for example about any of 1, 2, 3, 4, or 5) amino acid substitutions; an LC-CDR2 comprising the amino acid sequence of S
- the anti-E7MC antibody moiety comprises a heavy chain variable domain comprising an HC-CDR 1 comprising the amino acid sequence of SEQ ID NO: 69, an HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 90, and an HC- CDR3 comprising the amino acid sequence of SEQ ID NO: 111, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions in the HC-CDR sequences; and a light chain variable domain comprising an LC-CDRl comprising the amino acid sequence of SEQ ID NO: 132, an LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 153, and an LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 174, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions in the LC-CDR sequences.
- the anti-E7MC antibody moiety comprises a heavy chain variable domain comprising an HC-CDR 1 comprising the amino acid sequence of SEQ ID NO: 69, an HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 90, and an HC- CDR3 comprising the amino acid sequence of SEQ ID NO: 111; and a light chain variable domain comprising an LC-CDRl comprising the amino acid sequence of SEQ ID NO: 132, an LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 153, and an LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 174.
- the anti-E7MC antibody moiety comprises a heavy chain variable domain comprising an HC-CDR 1 comprising the amino acid sequence of SEQ ID NO: 70, or a variant thereof comprising up to about 5 (for example about any of 1, 2, 3, 4, or 5) amino acid substitutions; an HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 91, or a variant thereof comprising up to about 5 (for example about any of 1, 2, 3, 4, or 5) amino acid substitutions; and an HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 112, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions; and a light chain variable domain comprising an LC-CDRl comprising the amino acid sequence of SEQ ID NO: 133, or a variant thereof comprising up to about 5 (for example about any of 1, 2, 3, 4, or 5) amino acid substitutions; an LC-CDR2 comprising the amino acid sequence of SEQ
- the anti-E7MC antibody moiety comprises a heavy chain variable domain comprising an HC-CDR 1 comprising the amino acid sequence of SEQ ID NO: 70, an HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 91, and an HC- CDR3 comprising the amino acid sequence of SEQ ID NO: 112, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions in the HC-CDR sequences; and a light chain variable domain comprising an LC-CDRl comprising the amino acid sequence of SEQ ID NO: 133, an LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 154, and an LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 175, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions in the LC-CDR sequences.
- the anti-E7MC antibody moiety comprises a heavy chain variable domain comprising an HC-CDR 1 comprising the amino acid sequence of SEQ ID NO: 1
- an HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 91, and an HC-
- CDR3 comprising the amino acid sequence of SEQ ID NO: 112; and a light chain variable domain comprising an LC-CDRl comprising the amino acid sequence of SEQ ID NO: 133, an LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 154, and an LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 175.
- the anti-E7MC antibody moiety comprises a heavy chain variable domain comprising an HC-CDR 1 comprising the amino acid sequence of SEQ ID NO: 71, or a variant thereof comprising up to about 5 (for example about any of 1, 2, 3, 4, or 5) amino acid substitutions; an HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 92, or a variant thereof comprising up to about 5 (for example about any of 1, 2, 3, 4, or 5) amino acid substitutions; and an HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 113, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions; and a light chain variable domain comprising an LC-CDRl comprising the amino acid sequence of SEQ ID NO: 134, or a variant thereof comprising up to about 5 (for example about any of 1, 2, 3, 4, or 5) amino acid substitutions; an LC-CDR2 comprising the amino acid sequence of
- the anti-E7MC antibody moiety comprises a heavy chain variable domain comprising an HC-CDR 1 comprising the amino acid sequence of SEQ ID NO: 71, an HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 92, and an HC- CDR3 comprising the amino acid sequence of SEQ ID NO: 113, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions in the HC-CDR sequences; and a light chain variable domain comprising an LC-CDRl comprising the amino acid sequence of SEQ ID NO: 134, an LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 155, and an LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 176, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions in the LC-CDR sequences.
- the anti-E7MC antibody moiety comprises a heavy chain variable domain comprising an HC-CDR 1 comprising the amino acid sequence of SEQ ID NO: 71, an HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 92, and an HC- CDR3 comprising the amino acid sequence of SEQ ID NO: 113; and a light chain variable domain comprising an LC-CDRl comprising the amino acid sequence of SEQ ID NO: 134, an LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 155, and an LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 176.
- the anti-E7MC antibody moiety comprises a heavy chain variable domain comprising an HC-CDR 1 comprising the amino acid sequence of SEQ ID NO: 72, or a variant thereof comprising up to about 5 (for example about any of 1, 2, 3, 4, or 5) amino acid substitutions; an HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 93, or a variant thereof comprising up to about 5 (for example about any of 1, 2, 3, 4, or 5) amino acid substitutions; and an HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 114, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions; and a light chain variable domain comprising an LC-CDRl comprising the amino acid sequence of SEQ ID NO: 135, or a variant thereof comprising up to about 5 (for example about any of 1, 2, 3, 4, or 5) amino acid substitutions; an LC-CDR2 comprising the amino acid sequence of SEQ
- the anti-E7MC antibody moiety comprises a heavy chain variable domain comprising an HC-CDR 1 comprising the amino acid sequence of SEQ ID NO: 72, an HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 93, and an HC- CDR3 comprising the amino acid sequence of SEQ ID NO: 114, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions in the HC-CDR sequences; and a light chain variable domain comprising an LC-CDRl comprising the amino acid sequence of SEQ ID NO: 135, an LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 156, and an LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 177, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions in the LC-CDR sequences.
- the anti-E7MC antibody moiety comprises a heavy chain variable domain comprising an HC-CDR 1 comprising the amino acid sequence of SEQ ID NO: 72, an HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 93, and an HC- CDR3 comprising the amino acid sequence of SEQ ID NO: 114; and a light chain variable domain comprising an LC-CDRl comprising the amino acid sequence of SEQ ID NO: 135, an LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 156, and an LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 177.
- the anti-E7MC antibody moiety comprises a heavy chain variable domain comprising an HC-CDR 1 comprising the amino acid sequence of SEQ ID NO: 1
- NO: 73 or a variant thereof comprising up to about 5 (for example about any of 1, 2, 3, 4, or
- an HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 94, or a variant thereof comprising up to about 5 (for example about any of 1, 2, 3, 4, or 5) amino acid substitutions; and an HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 115, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions; and a light chain variable domain comprising an LC-CDRl comprising the amino acid sequence of SEQ ID NO: 136, or a variant thereof comprising up to about 5 (for example about any of 1, 2, 3, 4, or 5) amino acid substitutions; an LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 157, or a variant thereof comprising up to about 3 (for example about any of 1, 2, or 3) amino acid substitutions; and an LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 178, or a variant thereof comprising up to about 5 (such
- the anti-E7MC antibody moiety comprises a heavy chain variable domain comprising an HC-CDR 1 comprising the amino acid sequence of SEQ ID NO: 73, an HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 94, and an HC- CDR3 comprising the amino acid sequence of SEQ ID NO: 115, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions in the HC-CDR sequences; and a light chain variable domain comprising an LC-CDRl comprising the amino acid sequence of SEQ ID NO: 136, an LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 157, and an LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 178, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions in the LC-CDR sequences.
- the anti-E7MC antibody moiety comprises a heavy chain variable domain comprising an HC-CDR 1 comprising the amino acid sequence of SEQ ID NO: 73, an HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 94, and an HC- CDR3 comprising the amino acid sequence of SEQ ID NO: 115; and a light chain variable domain comprising an LC-CDRl comprising the amino acid sequence of SEQ ID NO: 136, an LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 157, and an LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 178.
- the anti-E7MC antibody moiety comprises a heavy chain variable domain comprising an HC-CDR 1 comprising the amino acid sequence of SEQ ID NO: 1
- NO: 74 or a variant thereof comprising up to about 5 (for example about any of 1, 2, 3, 4, or
- NO: 95 or a variant thereof comprising up to about 5 (for example about any of 1, 2, 3, 4, or
- an HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 116, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions; and a light chain variable domain comprising an LC-CDRl comprising the amino acid sequence of SEQ ID NO: 137, or a variant thereof comprising up to about 5 (for example about any of 1, 2, 3, 4, or 5) amino acid substitutions; an LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 158, or a variant thereof comprising up to about 3 (for example about any of 1, 2, or 3) amino acid substitutions; and an LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 179, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions.
- the anti-E7MC antibody moiety comprises a heavy chain variable domain comprising an HC-CDR 1 comprising the amino acid sequence of SEQ ID NO: 74, an HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 95, and an HC- CDR3 comprising the amino acid sequence of SEQ ID NO: 116, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions in the HC-CDR sequences; and a light chain variable domain comprising an LC-CDRl comprising the amino acid sequence of SEQ ID NO: 137, an LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 158, and an LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 179, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions in the LC-CDR sequences.
- the anti-E7MC antibody moiety comprises a heavy chain variable domain comprising an HC-CDR 1 comprising the amino acid sequence of SEQ ID NO: 74, an HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 95, and an HC- CDR3 comprising the amino acid sequence of SEQ ID NO: 116; and a light chain variable domain comprising an LC-CDRl comprising the amino acid sequence of SEQ ID NO: 137, an LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 158, and an LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 179.
- the anti-E7MC antibody moiety comprises a heavy chain variable domain comprising an HC-CDR 1 comprising the amino acid sequence of SEQ ID NO: 1
- NO: 75 or a variant thereof comprising up to about 5 (for example about any of 1, 2, 3, 4, or
- NO: 96 or a variant thereof comprising up to about 5 (for example about any of 1, 2, 3, 4, or
- ID NO: 117 or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or
- amino acid substitutions and a light chain variable domain comprising an LC-CDRl comprising the amino acid sequence of SEQ ID NO: 138, or a variant thereof comprising up to about 5 (for example about any of 1, 2, 3, 4, or 5) amino acid substitutions; an LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 159, or a variant thereof comprising up to about 3 (for example about any of 1, 2, or 3) amino acid substitutions; and an LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 180, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions.
- the anti-E7MC antibody moiety comprises a heavy chain variable domain comprising an HC-CDR 1 comprising the amino acid sequence of SEQ ID NO: 75, an HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 96, and an HC- CDR3 comprising the amino acid sequence of SEQ ID NO: 117, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions in the HC-CDR sequences; and a light chain variable domain comprising an LC-CDRl comprising the amino acid sequence of SEQ ID NO: 138, an LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 159, and an LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 180, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions in the LC-CDR sequences.
- the anti-E7MC antibody moiety comprises a heavy chain variable domain comprising an HC-CDR 1 comprising the amino acid sequence of SEQ ID NO: 75, an HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 96, and an HC- CDR3 comprising the amino acid sequence of SEQ ID NO: 117; and a light chain variable domain comprising an LC-CDRl comprising the amino acid sequence of SEQ ID NO: 138, an LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 159, and an LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 180.
- the anti-E7MC antibody moiety comprises a heavy chain variable domain comprising an HC-CDR 1 comprising the amino acid sequence of SEQ ID NO: 1
- NO: 76 or a variant thereof comprising up to about 5 (for example about any of 1, 2, 3, 4, or
- NO: 97 or a variant thereof comprising up to about 5 (for example about any of 1, 2, 3, 4, or
- ID NO: 118 or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or
- amino acid substitutions and a light chain variable domain comprising an LC-CDRl comprising the amino acid sequence of SEQ ID NO: 139, or a variant thereof comprising up to about 5 (for example about any of 1, 2, 3, 4, or 5) amino acid substitutions; an LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 160, or a variant thereof comprising up to about 3 (for example about any of 1, 2, or 3) amino acid substitutions; and an LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 181, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions.
- the anti-E7MC antibody moiety comprises a heavy chain variable domain comprising an HC-CDR 1 comprising the amino acid sequence of SEQ ID NO: 76, an HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 97, and an HC- CDR3 comprising the amino acid sequence of SEQ ID NO: 118, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions in the HC-CDR sequences; and a light chain variable domain comprising an LC-CDRl comprising the amino acid sequence of SEQ ID NO: 139, an LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 160, and an LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 181, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions in the LC-CDR sequences.
- the anti-E7MC antibody moiety comprises a heavy chain variable domain comprising an HC-CDR 1 comprising the amino acid sequence of SEQ ID NO: 76, an HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 97, and an HC- CDR3 comprising the amino acid sequence of SEQ ID NO: 118; and a light chain variable domain comprising an LC-CDRl comprising the amino acid sequence of SEQ ID NO: 139, an LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 160, and an LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 181.
- the anti-E7MC antibody moiety comprises a heavy chain variable domain comprising an HC-CDR 1 comprising the amino acid sequence of SEQ ID NO: 1
- NO: 77 or a variant thereof comprising up to about 5 (for example about any of 1, 2, 3, 4, or
- NO: 98 or a variant thereof comprising up to about 5 (for example about any of 1, 2, 3, 4, or
- ID NO: 119 or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or
- amino acid substitutions and a light chain variable domain comprising an LC-CDRl comprising the amino acid sequence of SEQ ID NO: 140, or a variant thereof comprising up to about 5 (for example about any of 1, 2, 3, 4, or 5) amino acid substitutions; an LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 161, or a variant thereof comprising up to about 3 (for example about any of 1, 2, or 3) amino acid substitutions; and an LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 182, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions.
- the anti-E7MC antibody moiety comprises a heavy chain variable domain comprising an HC-CDR 1 comprising the amino acid sequence of SEQ ID NO: 77, an HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 98, and an HC- CDR3 comprising the amino acid sequence of SEQ ID NO: 119, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions in the HC-CDR sequences; and a light chain variable domain comprising an LC-CDRl comprising the amino acid sequence of SEQ ID NO: 140, an LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 161, and an LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 182, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions in the LC-CDR sequences.
- the anti-E7MC antibody moiety comprises a heavy chain variable domain comprising an HC-CDR 1 comprising the amino acid sequence of SEQ ID NO: 77, an HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 98, and an HC- CDR3 comprising the amino acid sequence of SEQ ID NO: 119; and a light chain variable domain comprising an LC-CDRl comprising the amino acid sequence of SEQ ID NO: 140, an LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 161, and an LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 182.
- the anti-E7MC antibody moiety comprises a heavy chain variable domain comprising an HC-CDR 1 comprising the amino acid sequence of SEQ ID NO: 1
- NO: 77 or a variant thereof comprising up to about 5 (for example about any of 1, 2, 3, 4, or
- NO: 98 or a variant thereof comprising up to about 5 (for example about any of 1, 2, 3, 4, or
- ID NO: 244 or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or
- amino acid substitutions and a light chain variable domain comprising an LC-CDRl comprising the amino acid sequence of SEQ ID NO: 140, or a variant thereof comprising up to about 5 (for example about any of 1, 2, 3, 4, or 5) amino acid substitutions; an LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 161, or a variant thereof comprising up to about 3 (for example about any of 1, 2, or 3) amino acid substitutions; and an LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 182, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions.
- the anti-E7MC antibody moiety comprises a heavy chain variable domain comprising an HC-CDR 1 comprising the amino acid sequence of SEQ ID NO: 77, an HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 98, and an HC- CDR3 comprising the amino acid sequence of SEQ ID NO: 244, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions in the HC-CDR sequences; and a light chain variable domain comprising an LC-CDRl comprising the amino acid sequence of SEQ ID NO: 140, an LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 161, and an LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 182, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions in the LC-CDR sequences.
- the anti-E7MC antibody moiety comprises a heavy chain variable domain comprising an HC-CDR 1 comprising the amino acid sequence of SEQ ID NO: 77, an HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 98, and an HC- CDR3 comprising the amino acid sequence of SEQ ID NO: 244; and a light chain variable domain comprising an LC-CDRl comprising the amino acid sequence of SEQ ID NO: 140, an LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 161, and an LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 182.
- the anti-E7MC antibody moiety comprises a heavy chain variable domain comprising an HC-CDR 1 comprising the amino acid sequence of SEQ ID NO: 1
- NO: 77 or a variant thereof comprising up to about 5 (for example about any of 1, 2, 3, 4, or
- NO: 98 or a variant thereof comprising up to about 5 (for example about any of 1, 2, 3, 4, or
- amino acid substitutions and a light chain variable domain comprising an LC-CDRl comprising the amino acid sequence of SEQ ID NO: 140, or a variant thereof comprising up to about 5 (for example about any of 1, 2, 3, 4, or 5) amino acid substitutions; an LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 161, or a variant thereof comprising up to about 3 (for example about any of 1, 2, or 3) amino acid substitutions; and an LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 182, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions.
- the anti-E7MC antibody moiety comprises a heavy chain variable domain comprising an HC-CDR 1 comprising the amino acid sequence of SEQ ID NO: 77, an HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 98, and an HC- CDR3 comprising the amino acid sequence of SEQ ID NO: 245, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions in the HC-CDR sequences; and a light chain variable domain comprising an LC-CDRl comprising the amino acid sequence of SEQ ID NO: 140, an LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 161, and an LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 182, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions in the LC-CDR sequences.
- the anti-E7MC antibody moiety comprises a heavy chain variable domain comprising an HC-CDR 1 comprising the amino acid sequence of SEQ ID NO: 77, an HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 98, and an HC- CDR3 comprising the amino acid sequence of SEQ ID NO: 245; and a light chain variable domain comprising an LC-CDRl comprising the amino acid sequence of SEQ ID NO: 140, an LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 161, and an LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 182.
- the anti-E7MC antibody moiety comprises a heavy chain variable domain comprising an HC-CDR 1 comprising the amino acid sequence of SEQ ID NO: 1
- NO: 77 or a variant thereof comprising up to about 5 (for example about any of 1, 2, 3, 4, or
- NO: 98 or a variant thereof comprising up to about 5 (for example about any of 1, 2, 3, 4, or
- ID NO: 119 or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or
- amino acid substitutions and a light chain variable domain comprising an LC-CDRl comprising the amino acid sequence of SEQ ID NO: 140, or a variant thereof comprising up to about 5 (for example about any of 1, 2, 3, 4, or 5) amino acid substitutions; an LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 161, or a variant thereof comprising up to about 3 (for example about any of 1, 2, or 3) amino acid substitutions; and an LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 247, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions.
- the anti-E7MC antibody moiety comprises a heavy chain variable domain comprising an HC-CDR 1 comprising the amino acid sequence of SEQ ID NO: 1
- an HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 98, and an HC-
- CDR3 comprising the amino acid sequence of SEQ ID NO: 119, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions in the HC-CDR sequences; and a light chain variable domain comprising an LC-CDR1 comprising the amino acid sequence of SEQ ID NO: 140, an LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 161, and an LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 247, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions in the LC-CDR sequences.
- the anti-E7MC antibody moiety comprises a heavy chain variable domain comprising an HC-CDR 1 comprising the amino acid sequence of SEQ ID NO: 77, an HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 98, and an HC- CDR3 comprising the amino acid sequence of SEQ ID NO: 119; and a light chain variable domain comprising an LC-CDR1 comprising the amino acid sequence of SEQ ID NO: 140, an LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 161, and an LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 247.
- the anti-E7MC antibody moiety comprises a heavy chain variable domain comprising an HC-CDR 1 comprising the amino acid sequence of SEQ ID NO: 1
- NO: 77 or a variant thereof comprising up to about 5 (for example about any of 1, 2, 3, 4, or
- NO: 98 or a variant thereof comprising up to about 5 (for example about any of 1, 2, 3, 4, or
- ID NO: 119 or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or
- amino acid substitutions and a light chain variable domain comprising an LC-CDR1 comprising the amino acid sequence of SEQ ID NO: 140, or a variant thereof comprising up to about 5 (for example about any of 1, 2, 3, 4, or 5) amino acid substitutions; an LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 161, or a variant thereof comprising up to about 3 (for example about any of 1, 2, or 3) amino acid substitutions; and an LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 248, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions.
- the anti-E7MC antibody moiety comprises a heavy chain variable domain comprising an HC-CDR 1 comprising the amino acid sequence of SEQ ID NO: 1
- an HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 98, and an HC-
- CDR3 comprising the amino acid sequence of SEQ ID NO: 119, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions in the
- HC-CDR sequences comprising an LC-CDR1 comprising the amino acid sequence of SEQ ID NO: 140, an LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 161, and an LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 248, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions in the LC-CDR sequences.
- the anti-E7MC antibody moiety comprises a heavy chain variable domain comprising an HC-CDR1 comprising the amino acid sequence of SEQ ID NO: 77, an HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 98, and an HC- CDR3 comprising the amino acid sequence of SEQ ID NO: 119; and a light chain variable domain comprising an LC-CDR1 comprising the amino acid sequence of SEQ ID NO: 140, an LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 161, and an LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 248.
- the anti-E7MC antibody moiety comprises a heavy chain variable domain comprising an HC-CDR1 comprising the amino acid sequence of SEQ ID NO: 1
- NO: 77 or a variant thereof comprising up to about 5 (for example about any of 1, 2, 3, 4, or
- NO: 98 or a variant thereof comprising up to about 5 (for example about any of 1, 2, 3, 4, or
- ID NO: 119 or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or
- amino acid substitutions and a light chain variable domain comprising an LC-CDR1 comprising the amino acid sequence of SEQ ID NO: 246, or a variant thereof comprising up to about 5 (for example about any of 1, 2, 3, 4, or 5) amino acid substitutions; an LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 161, or a variant thereof comprising up to about 3 (for example about any of 1, 2, or 3) amino acid substitutions; and an LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 182, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions.
- the anti-E7MC antibody moiety comprises a heavy chain variable domain comprising an HC-CDR1 comprising the amino acid sequence of SEQ ID NO: 1
- an HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 98, and an HC-
- CDR3 comprising the amino acid sequence of SEQ ID NO: 119, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions in the
- HC-CDR sequences comprising an LC-CDR1 comprising the amino acid sequence of SEQ ID NO: 246, an LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 161, and an LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 182, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions in the LC-CDR sequences.
- the anti-E7MC antibody moiety comprises a heavy chain variable domain comprising an HC-CDR 1 comprising the amino acid sequence of SEQ ID NO: 77, an HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 98, and an HC- CDR3 comprising the amino acid sequence of SEQ ID NO: 119; and a light chain variable domain comprising an LC-CDRl comprising the amino acid sequence of SEQ ID NO: 246, an LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 161, and an LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 182.
- the anti-E7MC antibody moiety comprises a heavy chain variable domain comprising an HC-CDR 1 comprising the amino acid sequence of SEQ ID NO: 1
- NO: 77 or a variant thereof comprising up to about 5 (for example about any of 1, 2, 3, 4, or
- NO: 98 or a variant thereof comprising up to about 5 (for example about any of 1, 2, 3, 4, or
- ID NO: 119 or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or
- amino acid substitutions and a light chain variable domain comprising an LC-CDRl comprising the amino acid sequence of SEQ ID NO: 140, or a variant thereof comprising up to about 5 (for example about any of 1, 2, 3, 4, or 5) amino acid substitutions; an LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 161, or a variant thereof comprising up to about 3 (for example about any of 1, 2, or 3) amino acid substitutions; and an LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 249, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions.
- the anti-E7MC antibody moiety comprises a heavy chain variable domain comprising an HC-CDR 1 comprising the amino acid sequence of SEQ ID NO: 1
- an HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 98, and an HC-
- CDR3 comprising the amino acid sequence of SEQ ID NO: 119, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions in the
- HC-CDR sequences comprising an LC-CDRl comprising the amino acid sequence of SEQ ID NO: 140, an LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 161, and an LC-CDR3 comprising the amino acid sequence of SEQ
- ID NO: 249 or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or
- the anti-E7MC antibody moiety comprises a heavy chain variable domain comprising an HC-CDR 1 comprising the amino acid sequence of SEQ ID NO: 77, an HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 98, and an HC- CDR3 comprising the amino acid sequence of SEQ ID NO: 119; and a light chain variable domain comprising an LC-CDRl comprising the amino acid sequence of SEQ ID NO: 140, an LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 161, and an LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 249.
- the anti-E7MC antibody moiety comprises a heavy chain variable domain comprising an HC-CDR 1 comprising the amino acid sequence of SEQ ID NO: 77, or a variant thereof comprising up to about 5 (for example about any of 1, 2, 3, 4, or 5) amino acid substitutions; an HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 98, or a variant thereof comprising up to about 5 (for example about any of 1, 2, 3, 4, or 5) amino acid substitutions; and an HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 119, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions; and a light chain variable domain comprising an LC-CDRl comprising the amino acid sequence of SEQ ID NO: 140, or a variant thereof comprising up to about 5 (for example about any of 1, 2, 3, 4, or 5) amino acid substitutions; an LC-CDR2 comprising the amino acid sequence of S
- the anti-E7MC antibody moiety comprises a heavy chain variable domain comprising an HC-CDR 1 comprising the amino acid sequence of SEQ ID NO: 77, an HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 98, and an HC- CDR3 comprising the amino acid sequence of SEQ ID NO: 119, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions in the HC-CDR sequences; and a light chain variable domain comprising an LC-CDRl comprising the amino acid sequence of SEQ ID NO: 140, an LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 161, and an LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 250, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions in the LC-CDR sequences.
- the anti-E7MC antibody moiety comprises a heavy chain variable domain comprising an HC-CDR 1 comprising the amino acid sequence of SEQ ID NO: 77, an HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 98, and an HC- CDR3 comprising the amino acid sequence of SEQ ID NO: 119; and a light chain variable domain comprising an LC-CDR1 comprising the amino acid sequence of SEQ ID NO: 140, an LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 161, and an LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 250.
- the anti-E7MC antibody moiety comprises a heavy chain variable domain comprising the amino acid sequence set forth in SEQ ID NO: 15, or a variant thereof having at least about 95% (for example at least about any of 96%, 97%, 98%, or 99%) sequence identity, and a light chain variable domain comprising the amino acid sequence set forth in SEQ ID NO: 36, or a variant thereof having at least about 95% (including for example at least about any of 96%, 97%, 98%, or 99%) sequence identity.
- the anti-E7MC antibody moiety comprises a heavy chain variable domain comprising the amino acid sequence set forth in SEQ ID NO: 15 and a light chain variable domain comprising the amino acid sequence set forth in SEQ ID NO: 36.
- the anti-E7MC antibody moiety comprises a heavy chain variable domain comprising the amino acid sequence set forth in SEQ ID NO: 16, or a variant thereof having at least about 95% (including for example at least about any of 96%, 97%, 98%, or 99%) sequence identity, and a light chain variable domain comprising the amino acid sequence set forth in SEQ ID NO: 37, or a variant thereof having at least about 95%
- the anti-E7MC antibody moiety comprises a heavy chain variable domain comprising the amino acid sequence set forth in SEQ ID NO: 16 and a light chain variable domain comprising the amino acid sequence set forth in SEQ ID NO: 37.
- the anti-E7MC antibody moiety comprises a heavy chain variable domain comprising the amino acid sequence set forth in SEQ ID NO: 17, or a variant thereof having at least about 95% (for example at least about any of 96%, 97%, 98%, or 99%) sequence identity, and a light chain variable domain comprising the amino acid sequence set forth in SEQ ID NO: 38, or a variant thereof having at least about 95% (including for example at least about any of 96%, 97%, 98%, or 99%) sequence identity.
- the anti-E7MC antibody moiety comprises a heavy chain variable domain comprising the amino acid sequence set forth in SEQ ID NO: 17 and a light chain variable domain comprising the amino acid sequence set forth in SEQ ID NO: 38.
- the anti-E7MC antibody moiety comprises a heavy chain variable domain comprising the amino acid sequence set forth in SEQ ID NO: 18, or a variant thereof having at least about 95% (for example at least about any of 96%, 97%, 98%, or 99%) sequence identity, and a light chain variable domain comprising the amino acid sequence set forth in SEQ ID NO: 39, or a variant thereof having at least about 95% (including for example at least about any of 96%, 97%, 98%, or 99%) sequence identity.
- the anti-E7MC antibody moiety comprises a heavy chain variable domain comprising the amino acid sequence set forth in SEQ ID NO: 18 and a light chain variable domain comprising the amino acid sequence set forth in SEQ ID NO: 39.
- the anti-E7MC antibody moiety comprises a heavy chain variable domain comprising the amino acid sequence set forth in SEQ ID NO: 19, or a variant thereof having at least about 95% (for example at least about any of 96%, 97%, 98%, or 99%) sequence identity, and a light chain variable domain comprising the amino acid sequence set forth in SEQ ID NO: 40, or a variant thereof having at least about 95% (including for example at least about any of 96%, 97%, 98%, or 99%) sequence identity.
- the anti-E7MC antibody moiety comprises a heavy chain variable domain comprising the amino acid sequence set forth in SEQ ID NO: 19 and a light chain variable domain comprising the amino acid sequence set forth in SEQ ID NO: 40.
- the anti-E7MC antibody moiety comprises a heavy chain variable domain comprising the amino acid sequence set forth in SEQ ID NO: 20, or a variant thereof having at least about 95% (for example at least about any of 96%, 97%, 98%, or 99%) sequence identity, and a light chain variable domain comprising the amino acid sequence set forth in SEQ ID NO: 41, or a variant thereof having at least about 95% (including for example at least about any of 96%, 97%, 98%, or 99%) sequence identity.
- the anti-E7MC antibody moiety comprises a heavy chain variable domain comprising the amino acid sequence set forth in SEQ ID NO: 20 and a light chain variable domain comprising the amino acid sequence set forth in SEQ ID NO: 41.
- the anti-E7MC antibody moiety comprises a heavy chain variable domain comprising the amino acid sequence set forth in SEQ ID NO: 21, or a variant thereof having at least about 95% (for example at least about any of 96%, 97%, 98%, or 99%) sequence identity, and a light chain variable domain comprising the amino acid sequence set forth in SEQ ID NO: 42, or a variant thereof having at least about 95% (including for example at least about any of 96%, 97%, 98%, or 99%) sequence identity.
- the anti-E7MC antibody moiety comprises a heavy chain variable domain comprising the amino acid sequence set forth in SEQ ID NO: 21 and a light chain variable domain comprising the amino acid sequence set forth in SEQ ID NO: 42.
- the anti-E7MC antibody moiety comprises a heavy chain variable domain comprising the amino acid sequence set forth in SEQ ID NO: 22, or a variant thereof having at least about 95% (including for example at least about any of 96%, 97%,
- the anti-E7MC antibody moiety comprises a heavy chain variable domain comprising the amino acid sequence set forth in SEQ ID NO: 22 and a light chain variable domain comprising the amino acid sequence set forth in SEQ ID NO: 43.
- the anti-E7MC antibody moiety comprises a heavy chain variable domain comprising the amino acid sequence set forth in SEQ ID NO: 23, or a variant thereof having at least about 95% (for example at least about any of 96%, 97%, 98%, or 99%) sequence identity, and a light chain variable domain comprising the amino acid sequence set forth in SEQ ID NO: 44, or a variant thereof having at least about 95% (including for example at least about any of 96%, 97%, 98%, or 99%) sequence identity.
- the anti-E7MC antibody moiety comprises a heavy chain variable domain comprising the amino acid sequence set forth in SEQ ID NO: 23 and a light chain variable domain comprising the amino acid sequence set forth in SEQ ID NO: 44.
- the anti-E7MC antibody moiety comprises a heavy chain variable domain comprising the amino acid sequence set forth in SEQ ID NO: 24, or a variant thereof having at least about 95% (including for example at least about any of 96%, 97%,
- the anti-E7MC antibody moiety comprises a heavy chain variable domain comprising the amino acid sequence set forth in SEQ ID NO: 24 and a light chain variable domain comprising the amino acid sequence set forth in SEQ ID NO: 45.
- the anti-E7MC antibody moiety comprises a heavy chain variable domain comprising the amino acid sequence set forth in SEQ ID NO: 25, or a variant thereof having at least about 95% (including for example at least about any of 96%, 97%, 98%, or 99%) sequence identity, and a light chain variable domain comprising the amino acid sequence set forth in SEQ ID NO: 46, or a variant thereof having at least about 95%
- the anti-E7MC antibody moiety comprises a heavy chain variable domain comprising the amino acid sequence set forth in SEQ ID NO: 25 and a light chain variable domain comprising the amino acid sequence set forth in SEQ ID NO: 46.
- the anti-E7MC antibody moiety comprises a heavy chain variable domain comprising the amino acid sequence set forth in SEQ ID NO: 26, or a variant thereof having at least about 95% (including for example at least about any of 96%, 97%,
- the anti-E7MC antibody moiety comprises a heavy chain variable domain comprising the amino acid sequence set forth in SEQ ID NO: 26 and a light chain variable domain comprising the amino acid sequence set forth in SEQ ID NO: 47.
- the anti-E7MC antibody moiety comprises a heavy chain variable domain comprising the amino acid sequence set forth in SEQ ID NO: 27, or a variant thereof having at least about 95% (including for example at least about any of 96%, 97%,
- the anti-E7MC antibody moiety comprises a heavy chain variable domain comprising the amino acid sequence set forth in SEQ ID NO: 27 and a light chain variable domain comprising the amino acid sequence set forth in SEQ ID NO: 48.
- the anti-E7MC antibody moiety comprises a heavy chain variable domain comprising the amino acid sequence set forth in SEQ ID NO: 28, or a variant thereof having at least about 95% (including for example at least about any of 96%, 97%,
- the anti-E7MC antibody moiety comprises a heavy chain variable domain comprising the amino acid sequence set forth in SEQ ID NO: 28 and a light chain variable domain comprising the amino acid sequence set forth in SEQ ID NO: 49.
- the anti-E7MC antibody moiety comprises a heavy chain variable domain comprising the amino acid sequence set forth in SEQ ID NO: 29, or a variant thereof having at least about 95% (including for example at least about any of 96%, 97%,
- the anti-E7MC antibody moiety comprises a heavy chain variable domain comprising the amino acid sequence set forth in SEQ ID NO: 29 and a light chain variable domain comprising the amino acid sequence set forth in SEQ ID NO: 50.
- the anti-E7MC antibody moiety comprises a heavy chain variable domain comprising the amino acid sequence set forth in SEQ ID NO: 30, or a variant thereof having at least about 95% (including for example at least about any of 96%, 97%,
- the anti-E7MC antibody moiety comprises a heavy chain variable domain comprising the amino acid sequence set forth in SEQ ID NO: 30 and a light chain variable domain comprising the amino acid sequence set forth in SEQ ID NO: 51.
- the anti-E7MC antibody moiety comprises a heavy chain variable domain comprising the amino acid sequence set forth in SEQ ID NO: 31, or a variant thereof having at least about 95% (including for example at least about any of 96%, 97%,
- the anti-E7MC antibody moiety comprises a heavy chain variable domain comprising the amino acid sequence set forth in SEQ ID NO: 31 and a light chain variable domain comprising the amino acid sequence set forth in SEQ ID NO: 52.
- the anti-E7MC antibody moiety comprises a heavy chain variable domain comprising the amino acid sequence set forth in SEQ ID NO: 32, or a variant thereof having at least about 95% (including for example at least about any of 96%, 97%,
- the anti-E7MC antibody moiety comprises a heavy chain variable domain comprising the amino acid sequence set forth in SEQ ID NO: 32 and a light chain variable domain comprising the amino acid sequence set forth in SEQ ID NO: 53.
- the anti-E7MC antibody moiety comprises a heavy chain variable domain comprising the amino acid sequence set forth in SEQ ID NO: 33, or a variant thereof having at least about 95% (including for example at least about any of 96%, 97%,
- the anti-E7MC antibody moiety comprises a heavy chain variable domain comprising the amino acid sequence set forth in SEQ ID NO: 33 and a light chain variable domain comprising the amino acid sequence set forth in SEQ ID NO: 54.
- the anti-E7MC antibody moiety comprises a heavy chain variable domain comprising the amino acid sequence set forth in SEQ ID NO: 34, or a variant thereof having at least about 95% (including for example at least about any of 96%, 97%,
- the anti-E7MC antibody moiety comprises a heavy chain variable domain comprising the amino acid sequence set forth in SEQ ID NO: 34 and a light chain variable domain comprising the amino acid sequence set forth in SEQ ID NO: 55.
- the anti-E7MC antibody moiety comprises a heavy chain variable domain comprising the amino acid sequence set forth in SEQ ID NO: 35, or a variant thereof having at least about 95% (including for example at least about any of 96%, 97%,
- the anti-E7MC antibody moiety comprises a heavy chain variable domain comprising the amino acid sequence set forth in SEQ ID NO: 35 and a light chain variable domain comprising the amino acid sequence set forth in SEQ ID NO: 56.
- the anti-E7MC antibody moiety comprises a heavy chain variable domain comprising the amino acid sequence set forth in SEQ ID NO: 233, or a variant thereof having at least about 95% (including for example at least about any of 96%, 97%, 98%, or 99%) sequence identity, and a light chain variable domain comprising the amino acid sequence set forth in SEQ ID NO: 56, or a variant thereof having at least about
- the anti-E7MC antibody moiety comprises a heavy chain variable domain comprising the amino acid sequence set forth in SEQ ID NO: 233 and a light chain variable domain comprising the amino acid sequence set forth in SEQ ID NO: 56.
- the anti-E7MC antibody moiety comprises a heavy chain variable domain comprising the amino acid sequence set forth in SEQ ID NO: 234, or a variant thereof having at least about 95% (including for example at least about any of 96%,
- the anti-E7MC antibody moiety comprises a heavy chain variable domain comprising the amino acid sequence set forth in SEQ ID NO: 234 and a light chain variable domain comprising the amino acid sequence set forth in SEQ ID NO: 56.
- the anti-E7MC antibody moiety comprises a heavy chain variable domain comprising the amino acid sequence set forth in SEQ ID NO: 235, or a variant thereof having at least about 95% (including for example at least about any of 96%,
- the anti-E7MC antibody moiety comprises a heavy chain variable domain comprising the amino acid sequence set forth in SEQ ID NO: 235 and a light chain variable domain comprising the amino acid sequence set forth in SEQ ID NO: 56.
- the anti-E7MC antibody moiety comprises a heavy chain variable domain comprising the amino acid sequence set forth in SEQ ID NO: 35, or a variant thereof having at least about 95% (including for example at least about any of 96%, 97%,
- the anti-E7MC antibody moiety comprises a heavy chain variable domain comprising the amino acid sequence set forth in SEQ ID NO: 35 and a light chain variable domain comprising the amino acid sequence set forth in SEQ ID NO: 238. [0249] In some embodiments, the anti-E7MC antibody moiety comprises a heavy chain variable domain comprising the amino acid sequence set forth in SEQ ID NO: 35, or a variant thereof having at least about 95% (including for example at least about any of 96%, 97%,
- the anti-E7MC antibody moiety comprises a heavy chain variable domain comprising the amino acid sequence set forth in SEQ ID NO: 35 and a light chain variable domain comprising the amino acid sequence set forth in SEQ ID NO: 239.
- the anti-E7MC antibody moiety comprises a heavy chain variable domain comprising the amino acid sequence set forth in SEQ ID NO: 35, or a variant thereof having at least about 95% (including for example at least about any of 96%, 97%,
- the anti-E7MC antibody moiety comprises a heavy chain variable domain comprising the amino acid sequence set forth in SEQ ID NO: 35 and a light chain variable domain comprising the amino acid sequence set forth in SEQ ID NO: 240.
- the anti-E7MC antibody moiety comprises a heavy chain variable domain comprising the amino acid sequence set forth in SEQ ID NO: 35, or a variant thereof having at least about 95% (including for example at least about any of 96%, 97%,
- the anti-E7MC antibody moiety comprises a heavy chain variable domain comprising the amino acid sequence set forth in SEQ ID NO: 35 and a light chain variable domain comprising the amino acid sequence set forth in SEQ ID NO: 241.
- the anti-E7MC antibody moiety comprises a heavy chain variable domain comprising the amino acid sequence set forth in SEQ ID NO: 35, or a variant thereof having at least about 95% (including for example at least about any of 96%, 97%,
- the anti-E7MC antibody moiety comprises a heavy chain variable domain comprising the amino acid sequence set forth in SEQ ID NO: 35 and a light chain variable domain comprising the amino acid sequence set forth in SEQ ID NO: 242.
- the anti-E7MC antibody moiety comprises a heavy chain variable domain comprising the amino acid sequence set forth in SEQ ID NO: 236, or a variant thereof having at least about 95% (including for example at least about any of 96%, 97%, 98%, or 99%) sequence identity, and a light chain variable domain comprising the amino acid sequence set forth in SEQ ID NO: 243, or a variant thereof having at least about 95% (including for example at least about any of 96%, 97%, 98%, or 99%) sequence identity.
- the anti-E7MC antibody moiety comprises a heavy chain variable domain comprising the amino acid sequence set forth in SEQ ID NO: 236 and a light chain variable domain comprising the amino acid sequence set forth in SEQ ID NO: 243.
- the anti-E7MC antibody moiety comprises a heavy chain variable domain comprising the amino acid sequence set forth in SEQ ID NO: 237, or a variant thereof having at least about 95% (including for example at least about any of 96%, 97%, 98%, or 99%) sequence identity, and a light chain variable domain comprising the amino acid sequence set forth in SEQ ID NO: 56, or a variant thereof having at least about 95% (including for example at least about any of 96%, 97%, 98%, or 99%) sequence identity.
- the anti-E7MC antibody moiety comprises a heavy chain variable domain comprising the amino acid sequence set forth in SEQ ID NO: 237 and a light chain variable domain comprising the amino acid sequence set forth in SEQ ID NO: 56.
- the anti-E7MC antibody moiety competes for binding to a target HPV16-E7/MHC class I complex with a second anti-E7MC antibody moiety according to any of the anti-E7MC antibody moieties described herein. In some embodiments, the anti- E7MC antibody moiety binds to the same, or substantially the same, epitope as the second anti-E7MC antibody moiety.
- binding of the anti-E7MC antibody moiety to the target HPV16-E7/MHC class I complex inhibits binding of the second anti- E7MC antibody moiety to the target HPV16-E7/MHC class I complex by at least about 70% (such as by at least about any of 75%, 80%, 85%, 90%, 95%, 98% or 99%), or vice versa.
- the anti-E7MC antibody moiety and the second anti-E7MC antibody moiety cross-compete for binding to the target HPV16-E7/MHC class I complex, i.e., each of the antibody moieties competes with the other for binding to the target HPV16-E7/MHC class I complex.
- the anti-E7MC antibody moiety competes for binding to a target HPV16-E7/MHC class I complex with an antibody moiety comprising i) a heavy chain variable domain sequence comprising an HC-CDR1 comprising the amino acid sequence of SEQ ID NO: 183, or a variant thereof comprising up to about 3 (for example about any of 1, 2, or 3) amino acid substitutions, an HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 184 or 185, or a variant thereof comprising up to about 3 (for example about any of 1, 2, or 3) amino acid substitutions, and an HC-CDR3 comprising the amino acid sequence of any one of SEQ ID NOs: 186-188; or a variant thereof comprising up to about 3 (for example about any of 1, 2, or 3) amino acid substitutions; and ii) a light chain variable domain comprising an LC-CDRl comprising the amino acid sequence of SEQ ID NO: 189 or 190,
- the anti-E7MC antibody moiety competes for binding to a target HPV16-E7/MHC class I complex with an antibody moiety comprising i) a heavy chain variable domain sequence comprising an HC-CDR1 comprising (and in some embodiments consisting of) the amino acid sequence of any one of SEQ ID NOs: 57-77; or a variant thereof comprising up to about 5 (for example about any of 1, 2, 3, 4, or 5) amino acid substitutions; an HC-CDR2 comprising (and in some embodiments consisting of) the amino acid sequence of any one of SEQ ID NOs: 78-98; or a variant thereof comprising up to about 5 (for example about any of 1, 2, 3, 4, or 5) amino acid substitutions; and an HC-CDR3 comprising (and in some embodiments consisting of) the amino acid sequence of any one of SEQ ID NOs: 99-119, 244, and 245; or a variant thereof comprising up to about 5 (for example about any of 1, 2, 3,
- the anti-E7MC antibody moiety competes for binding to a target HPV16-E7/MHC class I complex with an antibody moiety comprising i) a heavy chain variable domain sequence comprising an HC-CDR1 comprising (and in some embodiments consisting of) the amino acid sequence of any one of SEQ ID NOs: 57-77; an HC-CDR2 comprising (and in some embodiments consisting of) the amino acid sequence of any one of SEQ ID NOs: 78-98; and an HC-CDR3 comprising (and in some embodiments consisting of) the amino acid sequence of any one of SEQ ID NOs: 99-119, 244, and 245; or a variant thereof comprising up to about 5 (for example about any of 1, 2, 3, 4, or 5) amino acid substitutions in the HC-CDR sequences; and ii) a light chain variable domain sequence comprising an LC-CDR1 comprising (and in some embodiments consisting of) the amino acid sequence of any one of SEQ ID NOs:
- the anti-E7MC antibody moiety competes for binding to a target HPV16-E7/MHC class I complex with an antibody moiety comprising a heavy chain variable domain comprising (and in some embodiments consisting of) the amino acid sequence of any one of SEQ ID NOs: 15-35 and 233-237, or a variant thereof having at least about 95% (for example at least about any of 96%, 97%, 98%, or 99%) sequence identity, and a light chain variable domain comprising (and in some embodiments consisting of) the amino acid sequence of any one of SEQ ID NOs: 36-56 and 238-243, or a variant thereof having at least about 95% (for example at least about any of 96%, 97%, 98%, or 99%) sequence identity.
- a heavy chain variable domain comprising (and in some embodiments consisting of) the amino acid sequence of any one of SEQ ID NOs: 15-35 and 233-237, or a variant thereof having at least about 95% (for example at least about any of 96%, 97%
- the anti-E7MC constructs in some embodiments are full-length antibodies comprising an anti-E7MC antibody moiety (also referred to herein as a "full-length anti- E7MC antibody").
- the full-length antibody is a monoclonal antibody.
- the full-length anti-E7MC antibody comprises an Fc sequence from an immunoglobulin, such as IgA, IgD, IgE, IgG, and IgM.
- the full-length anti-E7MC antibody comprises an Fc sequence of IgG, such as any of IgGl, IgG2, IgG3, or IgG4.
- the full-length anti-E7MC antibody comprises an Fc sequence of a human immunoglobulin. In some embodiments, the full-length anti-E7MC antibody comprises an Fc sequence of a mouse immunoglobulin. In some embodiments, the full-length anti-E7MC antibody comprises an Fc sequence that has been altered or otherwise changed so that it has enhanced antibody dependent cellular cytotoxicity (ADCC) or complement dependent cytotoxicity (CDC) effector function.
- ADCC antibody dependent cellular cytotoxicity
- CDC complement dependent cytotoxicity
- a full-length anti-E7MC antibody comprising a) an anti-E7MC antibody moiety that specifically binds to a complex comprising an HPV16-E7 peptide and an MHC class I protein, and b) an Fc region.
- the HPV16-E7 peptide is HPV16-E7 11-19 (SEQ ID NO: 4).
- the MHC class I protein is HLA-A02. In some embodiments, the MHC class I protein is HLA-A*02:01.
- a full-length anti-E7MC antibody comprising a) an anti-E7MC antibody moiety that specifically binds to a complex comprising an HPV16-E7 11-19 peptide (SEQ ID NO: 4) and HLA-A*02:01, and b) an Fc region.
- the Fc region comprises an IgGl Fc sequence.
- the Fc region comprises a human IgGl Fc sequence.
- the Fc region comprises a mouse IgGl Fc sequence.
- the anti-E7MC antibody moiety cross-reacts with at least one (such as at least any of 2, 3, 4, 5, or 6) complex comprising the MHC class I protein and a variant of the HPV16-E7 peptide having one amino acid substitution (such as a conservative amino acid substitution).
- at least one such as at least any of 2, 3, 4, 5, or 6
- a variant of the HPV16-E7 peptide having one amino acid substitution such as a conservative amino acid substitution.
- the anti-E7MC antibody moiety cross-reacts with at least one (such as at least any of 2, 3, 4, or 5) complex comprising the HPV16-E7 peptide and a different subtype of the MHC class I protein.
- a full-length anti-E7MC antibody comprising a) an anti-E7MC antibody moiety that specifically binds to a complex comprising an HPV16-E7 peptide and an MHC class I protein comprising i) a heavy chain variable domain sequence comprising an HC-CDR1 comprising the amino acid sequence of SEQ ID NO: 1
- an HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 183, or a variant thereof comprising up to about 3 (for example about any of 1, 2, or 3) amino acid substitutions, an HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 183, or a variant thereof comprising up to about 3 (for example about any of 1, 2, or 3) amino acid substitutions, an HC-CDR2 comprising the amino acid sequence of SEQ ID NO:
- the Fc region comprises an IgGl Fc sequence.
- the Fc region comprises a human IgGl Fc sequence.
- the Fc region comprises a mouse IgGl Fc sequence.
- a full-length anti-E7MC antibody comprising a) an anti-E7MC antibody moiety that specifically binds to a complex comprising an HPV16-E7 peptide and an MHC class I protein comprising i) a heavy chain variable domain sequence comprising an HC-CDR1 comprising the amino acid sequence of SEQ ID NO: 1
- an HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 184 or 185, and an HC-CDR3 comprising the amino acid sequence of any one of SEQ ID NOs: 186-188; and ii) a light chain variable domain comprising an LC-CDR1 comprising the amino acid sequence of SEQ ID NO: 189 or 190, and an LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 191, and b) an Fc region.
- the Fc region comprises an
- the Fc region comprises a human IgGl Fc sequence. In some embodiments, the Fc region comprises a mouse IgGl Fc sequence.
- a full-length anti-E7MC antibody comprising a) an anti-E7MC antibody moiety that specifically binds to a complex comprising an HPV16-E7 peptide and an MHC class I protein comprising i) a heavy chain variable domain comprising an HC-CDR1 comprising the amino acid sequence of any one of SEQ ID NO: 1
- NOs: 57-77 or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or
- an HC-CDR2 comprising the amino acid sequence of any one of
- SEQ ID NOs: 78-98 or a variant thereof comprising up to about 5 (such as about any of 1, 2,
- HC-CDR3 comprising the amino acid sequence of any one of SEQ ID NOs: 99-119, 244, and 245, or a variant thereof comprising up to about 5
- the Fc region comprises an IgGl Fc sequence.
- the Fc region comprises a human IgGl Fc sequence.
- the Fc region comprises a mouse IgGl Fc sequence.
- a full-length anti-E7MC antibody comprising a) an anti-E7MC antibody moiety that specifically binds to a complex comprising an HPV16-E7 peptide and an MHC class I protein comprising i) a heavy chain variable domain sequence comprising an HC-CDR1 comprising the amino acid sequence of any one of SEQ ID NOs: 57-77; an HC-CDR2 comprising the amino acid sequence of any one of
- the Fc region comprises an
- the Fc region comprises a human IgGl Fc sequence. In some embodiments, the Fc region comprises a mouse IgGl Fc sequence.
- a full-length anti-E7MC antibody comprising a) an anti-E7MC antibody moiety that specifically binds to a complex comprising an HPV16-E7 peptide and an MHC class I protein comprising i) a heavy chain variable domain sequence comprising an HC-CDR 1 comprising the amino acid sequence of any one of SEQ ID NOs: 57-77; an HC-CDR2 comprising the amino acid sequence of any one of
- the Fc region comprises an IgGl Fc sequence. In some embodiments, the Fc region comprises a human IgGl Fc sequence. In some embodiments, the Fc region comprises a mouse IgGl Fc sequence.
- a full-length anti-E7MC antibody comprising a) an anti-E7MC antibody moiety that specifically binds to a complex comprising an HPV16-E7 peptide and an MHC class I protein comprising a heavy chain variable domain comprising the amino acid sequence of any one of SEQ ID NOs: 15-35 and 233-237, or a variant thereof having at least about 95% (for example at least about any of 96%, 97%, 98%, or 99%) sequence identity, and a light chain variable domain comprising the amino acid sequence of any one of SEQ ID NOs: 36-56 and 238-243, or a variant thereof having at least about 95% (including for example at least about any of 96%, 97%, 98%, or 99%) sequence identity; and b) an Fc region.
- the Fc region comprises an IgGl Fc sequence.
- the Fc region comprises a human IgGl Fc sequence.
- a full-length anti-E7MC antibody comprising a) an anti-E7MC antibody moiety that specifically binds to a complex comprising an HPV16-E7 peptide and an MHC class I protein comprising a heavy chain variable domain comprising the amino acid sequence of any one of SEQ ID NOs: 15-35 and 233-237 and a light chain variable domain comprising the amino acid sequence of any one of SEQ ID NOs: 36-56 and 238-243; and b) an Fc region.
- the Fc region comprises an IgGl Fc sequence.
- the Fc region comprises a human IgGl Fc sequence.
- the Fc region comprises a mouse IgGl Fc sequence.
- the full-length anti-E7MC antibody binds to a complex comprising an HPV16-E7 peptide and an MHC class I protein with a K d between about 0.1 pM to about 500 nM (such as about any of 0.1 pM, 1.0 pM, 10 pM, 50 pM, 100 pM, 500 pM, 1 nM, 10 nM, 50 nM, 100 nM, or 500 nM, including any ranges between these values).
- the full-length anti-E7MC antibody binds to a complex comprising an HPV16-E7 peptide and an MHC class I protein with a K d between about 1 pM to about 250 pM (such as about any of 1, 10, 25, 50, 75, 100, 150, 200, or 250 pM, including any ranges between these values).
- Multi-Specific anti-E7MC molecules binds to a complex comprising an HPV16-E7 peptide and an MHC class I protein with a K d between about 1 pM to about 250 pM (such as about any of 1, 10, 25, 50, 75, 100, 150, 200, or 250 pM, including any ranges between these values).
- the anti-E7MC constructs in some embodiments comprise a multi- specific anti- E7MC molecule comprising an anti-E7MC antibody moiety and a second binding moiety (such as a second antigen-binding moiety).
- the multi- specific anti- E7MC molecule comprises an anti-E7MC antibody moiety and a second antigen-binding moiety.
- Multi- specific molecules are molecules that have binding specificities for at least two different antigens or epitopes (e.g., bispecific antibodies have binding specificities for two antigens or epitopes). Multi- specific molecules with more than two valencies and/or specificities are also contemplated. For example, trispecific antibodies can be prepared. Tutt et al. J. Immunol. 147: 60 (1991). It is to be appreciated that one of skill in the art could select appropriate features of individual multi- specific molecules described herein to combine with one another to form a multi-specific anti-E7MC molecule of the invention.
- a multi-specific (e.g. , bispecific) anti-E7MC molecule comprising a) an anti-E7MC antibody moiety that specifically binds to a complex comprising an HPV16-E7 peptide and an MHC class I protein, and b) a second binding moiety (such as an antigen-binding moiety).
- the second binding moiety specifically binds to a complex comprising a different HPV16-E7 peptide bound to the MHC class I protein.
- the second scFv specifically binds to a complex comprising the HPV16-E7 peptide bound to a different MHC class I protein.
- the second binding moiety specifically binds to a different epitope on the complex comprising the HPV16-E7 peptide and the MHC class I protein. In some embodiments, the second binding moiety specifically binds to a different antigen. In some embodiments, the second binding moiety specifically binds to an antigen on the surface of a cell, such as a cytotoxic cell. In some embodiments, the second binding moiety specifically binds to an antigen on the surface of a lymphocyte, such as a T cell, an NK cell, a neutrophil, a monocyte, a macrophage, or a dendritic cell. In some embodiments, the second binding moiety specifically binds to an effector T cell, such as a cytotoxic T cell (also known as cytotoxic T lymphocyte (CTL) or T killer cell).
- CTL cytotoxic T lymphocyte
- a multi-specific anti-E7MC molecule comprising a) an anti-E7MC antibody moiety that specifically binds to a complex comprising an HPV16-E7 peptide and an MHC class I protein, and b) a second antigen-binding moiety that binds specifically to CD3.
- the second antigen-binding moiety specifically binds to CD3s.
- the second antigen-binding moiety specifically binds to an agonistic epitope of CD3s.
- agonistic epitope means (a) an epitope that, upon binding of the multi- specific molecule, optionally upon binding of several multi- specific molecules on the same cell, allows said multi- specific molecules to activate TCR signaling and induce T cell activation, and/or (b) an epitope that is solely composed of amino acid residues of the epsilon chain of CD3 and is accessible for binding by the multi- specific molecule, when presented in its natural context on T cells (i.e. surrounded by the TCR, the CD3y chain, etc.), and/or (c) an epitope that, upon binding of the multi- specific molecule, does not lead to stabilization of the spatial position of CD3s relative to CD3y.
- a multi-specific anti-E7MC molecule comprising a) an anti-E7MC antibody moiety that specifically binds to a complex comprising an HPV16-E7 peptide and an MHC class I protein, and b) a second antigen-binding moiety that binds specifically to an antigen on the surface of an effector cell, including for example CD3y, CD35, CD3s, CD3C, CD28, CD16a, CD56, CD68, and GDS2D.
- a multi-specific anti-E7MC molecule comprising a) an anti-E7MC antibody moiety that specifically binds to a complex comprising an HPV16-E7 peptide and an MHC class I protein, and b) a second antigen-binding moiety that binds specifically to a component of the complement system, such as Clq.
- Clq is a subunit of the CI enzyme complex that activates the serum complement system.
- the second antigen-binding moiety specifically binds to an Fc receptor.
- the second antigen -binding moiety specifically binds to an Fey receptor (FcyR).
- the FcyR may be an FcyRIII present on the surface of natural killer (NK) cells or one of FcyRI, FcyRIIA, FcyRIIBI, FcyRIIB2, and FcyRIIIB present on the surface of macrophages, monocytes, neutrophils and/or dendritic cells.
- the second antigen-binding moiety is an Fc region or functional fragment thereof.
- “functional fragment” as used in this context refers to a fragment of an antibody Fc region that is still capable of binding to an FcR, in particular to an FcyR, with sufficient specificity and affinity to allow an FcyR bearing effector cell, in particular a macrophage, a monocyte, a neutrophil and/or a dendritic cell, to kill the target cell by cytotoxic lysis or phagocytosis.
- a functional Fc fragment is capable of competitively inhibiting the binding of the original, full- length Fc portion to an FcR such as the activating FcyRI.
- a functional fragment is capable of competitively inhibiting the binding of the original, full- length Fc portion to an FcR such as the activating FcyRI.
- Fc fragment retains at least 30%, 40%, 50%, 60%, 70%, 80%, 90% or 95% of its affinity to an activating FcyR.
- the Fc region or functional fragment thereof is an enhanced Fc region or functional fragment thereof.
- enhanced Fc region refers to an Fc region that is modified to enhance Fc receptor-mediated effector- functions, in particular antibody-dependent cell-mediated cytotoxicity (ADCC), complement- dependent cytotoxicity (CDC), and antibody-mediated phagocytosis. This can be achieved as known in the art, for example by altering the Fc region in a way that leads to an increased affinity for an activating receptor (e.g.
- the second antigen -binding moiety is an antibody or antigen-binding fragment thereof that specifically binds to an FcR, in particular to an FcyR, with sufficient specificity and affinity to allow an FcyR bearing effector cell, in particular a macrophage, a monocyte, a neutrophil and/or a dendritic cell, to kill the target cell by cytotoxic lysis or phagocytosis.
- the multi- specific anti-E7MC molecule allows killing of E7MC-presenting target cells and/or can effectively redirect CTLs to lyse E7MC-presenting target cells.
- the multi- specific (e.g. , bispecific) anti-E7MC molecule of the present invention shows an in vitro EC 50 ranging from 10 to 500 ng/ml, and is able to induce redirected lysis of about 50% of the target cells through CTLs at a ratio of CTLs to target cells of from about 1 : 1 to about 50: 1 (such as from about 1 : 1 to about 15: 1, or from about 2: 1 to about 10: 1).
- the multi- specific (e.g. , bispecific) anti-E7MC molecule is capable of cross-linking a stimulated or unstimulated CTL and the target cell in such a way that the target cell is lysed. This offers the advantage that no generation of target- specific T cell clones or common antigen presentation by dendritic cells is required for the multi- specific anti-E7MC molecule to exert its desired activity.
- the multi- specific anti-E7MC molecule of the present invention is capable of redirecting CTLs to lyse the target cells in the absence of other activating signals.
- the second antigen-binding moiety of the multi- specific anti-E7MC molecule specifically binds to CD3 (e.g. , specifically binds to CD3s), and signaling through CD28 and/or IL-2 is not required for redirecting CTLs to lyse the target cells.
- Methods for measuring the preference of the multi- specific anti-E7MC molecule to simultaneously bind to two antigens are within the normal capabilities of a person skilled in the art.
- the multi- specific anti-E7MC molecule may be contacted with a mixture of CD3 + /HPV16-E7 " cells and CD37HPV16-E7 + cells.
- the number of multi- specific anti-E7MC molecule-positive single cells and the number of cells cross-linked by multi- specific anti-E7MC molecules may then be assessed by microscopy or fluorescence- activated cell sorting (FACS) as known in the art.
- FACS fluorescence- activated cell sorting
- a multi-specific anti-E7MC molecule comprising a) an anti-E7MC antibody moiety that specifically binds to a complex comprising an HPV16-E7 peptide and an MHC class I protein, and b) a second antigen- binding moiety.
- the HPV16-E7 peptide is HPV16-E7 11-19 (SEQ ID NO: 4).
- the MHC class I protein is HLA-A02. In some embodiments, the MHC class I protein is HLA-A*02:01.
- the second antigen-binding moiety specifically binds to a complex comprising a different HPV16-E7 peptide bound to the MHC class I protein. In some embodiments, the second antigen-binding moiety specifically binds to a complex comprising the HPV16-E7 peptide bound to a different MHC class I protein. In some embodiments, the second antigen-binding moiety specifically binds to a different epitope on the complex comprising the HPV16-E7 peptide and the MHC class I protein. In some embodiments, the second antigen-binding moiety specifically binds to another antigen. In some embodiments, the second antigen-binding moiety specifically binds to an antigen on the surface of a cell, such as an E7MC-presenting cell. In some
- the second antigen-binding moiety specifically binds to an antigen on the surface of a cell that does not express HPV16-E7. In some embodiments, the second antigen- binding moiety specifically binds to an antigen on the surface of a cytotoxic cell. In some embodiments, the second antigen-binding moiety specifically binds to an antigen on the surface of a lymphocyte, such as a T cell, an NK cell, a neutrophil, a monocyte, a
- the second antigen-binding moiety specifically binds to an antigen on the surface of an effector T cell, such as a cytotoxic T cell. In some embodiments, the second antigen-binding moiety specifically binds to an antigen on the surface of an effector cell, including for example CD3y, CD35, CD3s, CD3 ⁇ , CD28, CD16a, CD56, CD68, and GDS2D. In some embodiments, the anti-E7MC antibody moiety is human, humanized, or semi- synthetic. In some embodiments, the second antigen-binding moiety is an antibody moiety.
- the second antigen-binding moiety is a human, humanized, or semi- synthetic antibody moiety.
- the multi- specific anti-E7MC molecule further comprises at least one (such as at least about any of 2, 3, 4, 5, or more) additional antigen-binding moieties.
- the anti-E7MC antibody moiety cross-reacts with at least one (such as at least any of 2, 3, 4, 5, or 6) complex comprising the MHC class I protein and a variant of the HPV16-E7 peptide having one amino acid substitution (such as a conservative amino acid substitution).
- the anti-E7MC antibody moiety cross-reacts with at least one (such as at least any of 2, 3, 4, or 5) complex comprising the HPV16-E7 peptide and a different subtype of the MHC class I protein.
- a multi-specific anti-E7MC molecule comprising a) an anti-E7MC antibody moiety that specifically binds to a complex comprising an HPV16-E7 11-19 peptide (SEQ ID NO: 4) and HLA-A*02:01, and b) a second antigen- binding moiety.
- a multi-specific anti-E7MC molecule comprising a) an anti-E7MC antibody moiety that specifically binds to a complex comprising an HPV16-E7 peptide and an MHC class I protein comprising i) a heavy chain variable domain sequence comprising an HC-CDR1 comprising the amino acid sequence of SEQ ID NO: 183, or a variant thereof comprising up to about 3 (for example about any of 1, 2, or 3) amino acid substitutions, an HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 184 or 185, or a variant thereof comprising up to about 3 (for example about any of 1, 2, or 3) amino acid substitutions, and an HC-CDR3 comprising the amino acid sequence of any one of SEQ ID NOs: 186-188, or a variant thereof comprising up to about 3 (for example about any of 1, 2, or 3) amino acid substitutions; and ii) a light chain variable domain comprising an LC-C
- an LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 191, or a variant thereof comprising up to about 3 (for example about any of 1, 2, or 3) amino acid substitutions, and b) a second antigen-binding moiety.
- a multi-specific anti-E7MC molecule comprising a) an anti-E7MC antibody moiety that specifically binds to a complex comprising an HPV16-E7 peptide and an MHC class I protein comprising i) a heavy chain variable domain sequence comprising an HC-CDR1 comprising the amino acid sequence of SEQ ID NO: 1
- an HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 184 or 185, and an HC-CDR3 comprising the amino acid sequence of any one of SEQ ID NOs: 186-188; and ii) a light chain variable domain comprising an LC-CDR1 comprising the amino acid sequence of SEQ ID NO: 189 or 190, and an LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 191, and b) a second antigen-binding moiety.
- a multi-specific anti-E7MC molecule comprising a) an anti-E7MC antibody moiety that specifically binds to a complex comprising an HPV16-E7 peptide and an MHC class I protein comprising i) a heavy chain variable domain comprising an HC-CDR1 comprising the amino acid sequence of any one of SEQ ID NOs: 57-77, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions, an HC-CDR2 comprising the amino acid sequence of any one of SEQ ID NOs: 78-98, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions, and an HC-CDR3 comprising the amino acid sequence of any one of SEQ ID NOs: 99-119, 244, and 245, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions;
- a multi-specific anti-E7MC molecule comprising a) an anti-E7MC antibody moiety that specifically binds to a complex comprising an HPV16-E7 peptide and an MHC class I protein comprising i) a heavy chain variable domain sequence comprising an HC-CDR1 comprising the amino acid sequence of any one of SEQ ID NOs: 57-77; an HC-CDR2 comprising the amino acid sequence of any one of SEQ ID NOs: 78-98; and an HC-CDR3 comprising the amino acid sequence of any one of SEQ ID NOs: 99-119, 244, and 245; or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions in the HC-CDR sequences; and ii) a light chain variable domain sequence comprising an LC-CDR1 comprising the amino acid sequence of any one of SEQ ID NOs: 120-140 and 246; an LC
- a multi-specific anti-E7MC molecule comprising a) an anti-E7MC antibody moiety that specifically binds to a complex comprising an HPV16-E7 peptide and an MHC class I protein comprising i) a heavy chain variable domain sequence comprising an HC-CDR1 comprising the amino acid sequence of any one of SEQ ID NOs: 57-77; an HC-CDR2 comprising the amino acid sequence of any one of SEQ ID NOs: 78-98; and an HC-CDR3 comprising the amino acid sequence of any one of SEQ ID NOs: 99-119, 244, and 245; and ii) a light chain variable domain sequence comprising an LC-CDR 1 comprising the amino acid sequence of any one of SEQ ID NOs: 120-140 and 246; an LC-CDR2 comprising the amino acid sequence of any one of SEQ ID NOs: 141-161 ; and an LC-CDR3 comprising the amino
- a multi-specific anti-E7MC molecule comprising a) an anti-E7MC antibody moiety comprising a heavy chain variable domain comprising the amino acid sequence of any one of SEQ ID NOs: 15-35 and 233-237, or a variant thereof having at least about 95% (for example at least about any of 96%, 97%, 98%, or 99%) sequence identity, and a light chain variable domain comprising the amino acid sequence of any one of SEQ ID NOs: 36-56 and 238-243, or a variant thereof having at least about 95% (including for example at least about any of 96%, 97%, 98%, or 99%) sequence identity; and b) a second scFv.
- a multi-specific anti-E7MC molecule comprising a) an anti-E7MC antibody moiety comprising a heavy chain variable domain comprising the amino acid sequence of any one of SEQ ID NOs: 15-35 and 233-237 and a light chain variable domain comprising the amino acid sequence of any one of SEQ ID NOs: 36-56 and 238-243; and b) a second antigen-binding moiety.
- the multi- specific anti-E7MC molecule is, for example, a diabody (Db), a single-chain diabody (scDb), a tandem scDb (Tandab), a linear dimeric scDb
- LD-scDb a circular dimeric scDb
- CD-scDb a di-diabody
- a tandem scFv a tandem di- scFv (e.g. , a bispecific T cell engager)
- a tandem tri-scFv a tri(a)body, a bispecific Fab2, a di-miniantibody, a tetrabody, an scFv-Fc-scFv fusion, a dual-affinity retargeting (DART) antibody, a dual variable domain (DVD) antibody
- IgG-scFab an scFab-ds-scFv
- an Fv2- variable domain
- the multi- specific anti-E7MC molecule is a tandem scFv (e.g. , a tandem di- scFv, such as a bispecific T cell engager).
- the multi- specific anti-E7MC molecule in some embodiments is a tandem scFv comprising a first scFv comprising an anti-E7MC antibody moiety and a second scFv (also referred to herein as a "tandem scFv multi- specific anti-E7MC antibody").
- the tandem scFv multi- specific anti-E7MC antibody further comprises at least one (such as at least about any of 2, 3, 4, 5, or more) additional scFv.
- tandem scFv multi-specific (e.g. , bispecific) anti-E7MC antibody comprising a) a first scFv that specifically binds to a complex comprising an HPV16-E7 peptide and an MHC class I protein, and b) a second scFv.
- the HPV16-E7 peptide is HPV16-E7 11-19 (SEQ ID NO: 4).
- the MHC class I protein is HLA-A02. In some embodiments, the MHC class I protein is HLA-A*02:01.
- the second scFv specifically binds to a complex comprising a different HPV16-E7 peptide bound to the MHC class I protein. In some embodiments, the second scFv specifically binds to a complex comprising the HPV16- E7 peptide bound to a different MHC class I protein. In some embodiments, the second scFv specifically binds to a different epitope on the complex comprising the HPV16-E7 peptide and the MHC class I protein. In some embodiments, the second scFv specifically binds to another antigen. In some embodiments, the second scFv specifically binds to an antigen on the surface of a cell, such as an E7MC-presenting cell.
- the second scFv specifically binds to an antigen on the surface of a cell that does not express HPV16-E7. In some embodiments, the second scFv specifically binds to an antigen on the surface of a cytotoxic cell. In some embodiments, the second scFv specifically binds to an antigen on the surface of a lymphocyte, such as a T cell, an NK cell, a neutrophil, a monocyte, a
- the second scFv specifically binds to an antigen on the surface of an effector T cell, such as a cytotoxic T cell.
- the second scFv specifically binds to an antigen on the surface of an effector cell, including for example CD3y, CD35, CD3s, ⁇ 3 ⁇ , CD28, CD16a, CD56, CD68, and GDS2D.
- the first scFv is human, humanized, or semi-synthetic.
- the second scFv is human, humanized, or semi- synthetic.
- both the first scFv and the second scFv are human, humanized, or semisynthetic.
- the tandem scFv multi- specific anti-E7MC antibody further comprises at least one (such as at least about any of 2, 3, 4, 5, or more) additional scFv.
- the anti-E7MC antibody moiety cross-reacts with at least one (such as at least any of 2, 3, 4, 5, or 6) complex comprising the MHC class I protein and a variant of the HPV16-E7 peptide having one amino acid substitution (such as a conservative amino acid substitution).
- the anti-E7MC antibody moiety cross-reacts with at least one (such as at least any of 2, 3, 4, or 5) complex comprising the HPV16-E7 peptide and a different subtype of the MHC class I protein.
- tandem scFv multi-specific (e.g. , bispecific) anti-E7MC antibody comprising a) a first scFv that specifically binds to a complex comprising an HPV16-E7 11- 19 peptide (SEQ ID NO: 4) and HLA-A*02:01, and b) a second scFv.
- tandem scFv multi-specific (e.g. , bispecific) anti-E7MC antibody comprising a) a first scFv that specifically binds to a complex comprising an HPV16-E7 peptide and an MHC class I protein comprising i) a heavy chain variable domain sequence comprising an HC-CDR1 comprising the amino acid sequence of SEQ ID NO: 183, or a variant thereof comprising up to about 3 (for example about any of 1, 2, or 3) amino acid substitutions, an HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 184 or 185, or a variant thereof comprising up to about 3 (for example about any of 1, 2, or 3) amino acid substitutions, and an HC-CDR3 comprising the amino acid sequence of any one of SEQ ID NOs: 186-188, or a variant thereof comprising up to about 3 (for example about any of 1, 2, or 3) amino acid substitutions; and ii
- tandem scFv multi-specific (e.g. , bispecific) anti-E7MC antibody comprising a) a first scFv that specifically binds to a complex comprising an HPV16-E7 peptide and an MHC class I protein comprising i) a heavy chain variable domain sequence comprising an HC-CDR1 comprising the amino acid sequence of SEQ ID NO: 183, an HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 184 or 185, and an HC-CDR3 comprising the amino acid sequence of any one of SEQ ID NOs: 186-188; and ii) a light chain variable domain comprising an LC-CDR1 comprising the amino acid sequence of SEQ ID NO: 189 or 190, and an LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 191, and b) a second scFv.
- a first scFv that specifically binds to a complex comprising an HPV16
- tandem scFv multi-specific (e.g. , bispecific) anti-E7MC antibody comprising a) a first scFv that specifically binds to a complex comprising an HPV16-E7 peptide and an MHC class I protein comprising i) a heavy chain variable domain comprising an HC-CDR1 comprising the amino acid sequence of any one of SEQ ID NOs: 57-77, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions, an HC-CDR2 comprising the amino acid sequence of any one of SEQ ID NOs: 78-98, or a variant thereof comprising up to about 5
- an HC-CDR3 comprising the amino acid sequence of any one of SEQ ID NOs: 99- 119, 244, and 245, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid
- a light chain variable domain comprising an LC-CDR1 comprising the amino acid sequence of any one of SEQ ID NOs: 120-140 and 246, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions, an
- LC-CDR2 comprising the amino acid sequence of any one of SEQ ID NOs: 141- 161, or a variant thereof comprising up to about 3 (such as about any of 1, 2, or 3) amino acid substitutions
- an LC-CDR3 comprising the amino acid sequence of any one of SEQ ID NOs: 141- 161, or a variant thereof comprising up to about 3 (such as about any of 1, 2, or 3) amino acid substitutions
- an LC-CDR3 comprising the amino acid sequence of any one of SEQ ID
- tandem scFv multi-specific (e.g. , bispecific) anti-E7MC antibody comprising a) a first scFv that specifically binds to a complex comprising an HPV16-E7 peptide and an MHC class I protein comprising i) a heavy chain variable domain sequence comprising an HC-CDR1 comprising the amino acid sequence of any one of SEQ ID NOs: 57-77; an HC-CDR2 comprising the amino acid sequence of any one of SEQ ID NOs: 78-98; and an HC-CDR3 comprising the amino acid sequence of any one of SEQ ID NOs: 99- 119, 244, and 245; or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions in the HC-CDR sequences; and ii) a light chain variable domain sequence comprising an LC-CDR1 comprising the amino acid sequence of any one of S
- tandem scFv multi-specific (e.g. , bispecific) anti-E7MC antibody comprising a) a first scFv that specifically binds to a complex comprising an HPV16-E7 peptide and an MHC class I protein comprising i) a heavy chain variable domain sequence comprising an HC-CDR1 comprising the amino acid sequence of any one of SEQ ID NOs: 57-77; an HC-CDR2 comprising the amino acid sequence of any one of SEQ ID NOs: 78-98; and an HC-CDR3 comprising the amino acid sequence of any one of SEQ ID NOs: 99- 119, 244, and 245; and ii) a light chain variable domain sequence comprising an LC-CDR1 comprising the amino acid sequence of any one of SEQ ID NOs: 120-140 and 246; an LC-CDR2 comprising the amino acid sequence of any one of SEQ ID NOs: 141-16
- tandem scFv multi-specific (e.g. , bispecific) anti-E7MC antibody comprising a) a first scFv comprising a heavy chain variable domain comprising the amino acid sequence of any one of SEQ ID NOs: 15-35 and 233-237, or a variant thereof having at least about 95% (for example at least about any of 96%, 97%, 98%, or 99%) sequence identity, and a light chain variable domain comprising the amino acid sequence of any one of SEQ ID NOs: 36-56 and 238-243, or a variant thereof having at least about 95% (including for example at least about any of 96%, 97%, 98%, or 99%) sequence identity; and b) a second scFv.
- a first scFv comprising a heavy chain variable domain comprising the amino acid sequence of any one of SEQ ID NOs: 15-35 and 233-237, or a variant thereof having at least about 95% (for example at least about any of 96%, 97%, 9
- tandem scFv multi-specific (e.g. , bispecific) anti-E7MC antibody comprising a) a first scFv comprising a heavy chain variable domain comprising the amino acid sequence of any one of SEQ ID NOs: 15-35 and 233-237 and a light chain variable domain comprising the amino acid sequence of any one of SEQ ID NOs: 36-56 and 238-243; and b) a second scFv.
- tandem scFv multi-specific (e.g. , bispecific) anti-E7MC antibody comprising a) a first scFv that specifically binds to a complex comprising an HPV16-E7 peptide and an MHC class I protein, and b) a second scFv, wherein the tandem scFv multi- specific anti-E7MC antibody is a tandem di-scFv or a tandem tri-scFv.
- the tandem scFv multi- specific anti-E7MC antibody is a tandem di-scFv.
- the tandem scFv multi- specific anti-E7MC antibody is a bispecific T-cell engager.
- tandem di-scFv bispecific anti-E7MC antibody comprising a) a first scFv that specifically binds to a complex comprising an HPV16-E7 peptide and an MHC class I protein, and b) a second scFv that specifically binds to an antigen on the surface of a T cell.
- the HPV16- E7 peptide is HPV16-E7 11-19 (SEQ ID NO: 4).
- the MHC class I protein is HLA-A02. In some embodiments, the MHC class I protein is HLA-A*02:01.
- the second scFv specifically binds to an antigen on the surface of an effector T cell, such as a cytotoxic T cell.
- the second scFv specifically binds to an antigen selected, for example, from the group consisting of CD3y, CD35, CD3s, CD3C, CD28, OX40, GITR, CD137, CD27, CD40L, and HVEM.
- the second scFv specifically binds to an agonistic epitope on an antigen on the surface of a T cell, wherein the binding of the second scFv to the antigen enhances T cell activation.
- the first scFv is human, humanized, or semi- synthetic.
- the second scFv is human, humanized, or semi-synthetic.
- both the first scFv and the second scFv are human, humanized, or semi-synthetic.
- tandem di-scFv bispecific anti-E7MC antibody comprising a) a first scFv that specifically binds to a complex comprising an HPV16-E7 11-19 peptide (SEQ ID NO: 4) and HLA-A*02:01, and b) a second scFv that specifically binds to an antigen on the surface of a T cell.
- tandem di-scFv bispecific anti-E7MC antibody comprising a) a first scFv that specifically binds to a complex comprising an
- HPV16-E7 peptide and an MHC class I protein comprising i) a heavy chain variable domain sequence comprising an HC-CDR1 comprising the amino acid sequence of SEQ ID NO: 183, or a variant thereof comprising up to about 3 (for example about any of 1, 2, or 3) amino acid substitutions, an HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 184 or 185, or a variant thereof comprising up to about 3 (for example about any of 1, 2, or 3) amino acid substitutions, and an HC-CDR3 comprising the amino acid sequence of any one of SEQ ID
- a light chain variable domain comprising an LC-CDR1 comprising the amino acid sequence of SEQ ID NO: 189 or 190, or a variant thereof comprising up to about 3 (for example about any of 1, 2, or 3) amino acid substitutions, and an LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 191, or a variant thereof comprising up to about 3 (for example about any of 1, 2, or 3) amino acid substitutions, and b) a second scFv that specifically binds to an antigen on the surface of a T cell.
- tandem di-scFv bispecific anti-E7MC antibody comprising a) a first scFv that specifically binds to a complex comprising an
- HPV16-E7 peptide and an MHC class I protein comprising i) a heavy chain variable domain sequence comprising an HC-CDRl comprising the amino acid sequence of SEQ ID NO: 183, an HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 184 or 185, and an HC-
- CDR3 comprising the amino acid sequence of any one of SEQ ID NOs: 186-188; and ii) a light chain variable domain comprising an LC-CDR1 comprising the amino acid sequence of
- tandem di-scFv bispecific anti-E7MC antibody comprising a) a first scFv that specifically binds to a complex comprising an
- HPV16-E7 peptide and an MHC class I protein comprising i) a heavy chain variable domain comprising an HC-CDRl comprising the amino acid sequence of any one of SEQ ID NOs:
- HC-CDR2 comprising the amino acid sequence of any one of
- SEQ ID NOs: 78-98 or a variant thereof comprising up to about 5 (such as about any of 1, 2,
- HC-CDR3 comprising the amino acid sequence of any one of SEQ ID NOs: 99-119, 244, and 245, or a variant thereof comprising up to about 5
- an LC-CDR2 comprising the amino acid sequence of any one of SEQ ID NOs: 141-161, or a variant thereof comprising up to about 3 (such as about any of 1, 2, or 3) amino acid substitutions
- an LC-CDR3 comprising the amino acid sequence of any one of SEQ ID NOs: 162-182 and 247-250, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions
- a second scFv that specifically binds to an antigen on the surface of a T cell.
- tandem di-scFv bispecific anti-E7MC antibody comprising a) a first scFv that specifically binds to a complex comprising an
- HPV16-E7 peptide and an MHC class I protein comprising i) a heavy chain variable domain sequence comprising an HC-CDR1 comprising the amino acid sequence of any one of SEQ ID NOs: 57-77; an HC-CDR2 comprising the amino acid sequence of any one of SEQ ID NOs: 78-98; and an HC-CDR3 comprising the amino acid sequence of any one of SEQ ID NOs: 99-119, 244, and 245; or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions in the HC-CDR sequences; and ii) a light chain variable domain sequence comprising an LC-CDR1 comprising the amino acid sequence of any one of SEQ ID NOs: 120-140 and 246; an LC-CDR2 comprising the amino acid sequence of any one of SEQ ID NOs: 141-161; and an LC-CDR3 comprising the amino acid sequence of any one of SEQ ID NOs:
- tandem di-scFv bispecific anti-E7MC antibody comprising a) a first scFv that specifically binds to a complex comprising an HPV16-E7 peptide and an MHC class I protein comprising i) a heavy chain variable domain sequence comprising an HC-CDR 1 comprising the amino acid sequence of any one of SEQ ID NOs: 57-77; an HC-CDR2 comprising the amino acid sequence of any one of SEQ ID NOs: 78-98; and an HC-CDR3 comprising the amino acid sequence of any one of SEQ ID NOs: 99-119, 244, and 245; and ii) a light chain variable domain sequence comprising an LC-CDR1 comprising the amino acid sequence of any one of SEQ ID NOs: 120-140 and 246; an LC-CDR2 comprising the amino acid sequence of any one of SEQ ID NOs: 141-161; and an LC-CDR3 compris
- tandem di-scFv bispecific anti-E7MC antibody comprising a) a first scFv comprising a heavy chain variable domain comprising the amino acid sequence of any one of SEQ ID NOs: 15-35 and 233-237, or a variant thereof having at least about 95% (for example at least about any of 96%, 97%, 98%, or 99%) sequence identity, and a light chain variable domain comprising the amino acid sequence of any one of SEQ ID NOs: 36-56 and 238-243, or a variant thereof having at least about 95% (for example at least about any of 96%, 97%, 98%, or 99%) sequence identity, and b) a second scFv that specifically binds to an antigen on the surface of a T cell.
- tandem di-scFv bispecific anti-E7MC antibody comprising a) a first scFv comprising a heavy chain variable domain comprising the amino acid sequence of any one of SEQ ID NOs: 15-35 and 233-237 and a light chain variable domain comprising the amino acid sequence of any one of SEQ ID NOs: 36-56 and 238-243, and b) a second scFv that specifically binds to an antigen on the surface of a T cell.
- tandem di-scFv bispecific anti-E7MC antibody comprising a) a first scFv that specifically binds to a complex comprising an HPV16-E7 peptide and an MHC class I protein, and b) a second scFv that specifically binds to CD3s.
- the HPV16-E7 peptide is HPV16-E7 11-19 (SEQ ID NO: 4).
- the MHC class I protein is HLA-A02. In some embodiments, the MHC class I protein is HLA-A*02:01.
- the first scFv is fused to the second scFv through linkage with a peptide linker.
- the peptide linker is between about 5 to about 20 (such as about any of 5, 10, 15, or 20, including any ranges between these values) amino acids in length.
- the peptide linker comprises (and in some embodiments consists of) the amino acid sequence GGGGS.
- the first scFv is human, humanized, or semi- synthetic.
- the second scFv is human, humanized, or semi-synthetic. In some embodiments, both the first scFv and the second scFv are human, humanized, or semi-synthetic.
- tandem di-scFv bispecific anti-E7MC antibody comprising a) a first scFv that specifically binds to a complex comprising an HPV16-E7 11-19 peptide (SEQ ID NO: 4) and HLA-A*02:01, and b) a second scFv that specifically binds to CD3s.
- the first scFv is fused to the second scFv through linkage with a peptide linker.
- the peptide linker is between about 5 to about 20 (such as about any of 5, 10, 15, or 20, including any ranges between these values) amino acids in length.
- the peptide linker comprises (and in some embodiments consists of) the amino acid sequence GGGGS.
- the first scFv is human, humanized, or semi-synthetic.
- the second scFv is human, humanized, or semi- synthetic.
- both the first scFv and the second scFv are human, humanized, or semi-synthetic.
- tandem di-scFv bispecific anti-E7MC antibody comprising a) a first scFv that specifically binds to a complex comprising an
- HPV16-E7 peptide and an MHC class I protein comprising i) a heavy chain variable domain sequence comprising an HC-CDRl comprising the amino acid sequence of SEQ ID NO: 183, or a variant thereof comprising up to about 3 (for example about any of 1, 2, or 3) amino acid substitutions, an HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 184 or 185, or a variant thereof comprising up to about 3 (for example about any of 1, 2, or 3) amino acid substitutions, and an HC-CDR3 comprising the amino acid sequence of any one of SEQ ID NOs: 186-188, or a variant thereof comprising up to about 3 (for example about any of 1, 2, or 3) amino acid substitutions; and ii) a light chain variable domain comprising an LC-CDR1 comprising the amino acid sequence of SEQ ID NO: 189 or 190, or a variant thereof comprising up to about 3 (for example about any of 1, 2, or 3) amino acid substitutions, and an
- the first scFv is fused to the second scFv through linkage with a peptide linker.
- the peptide linker is between about 5 to about 20 (such as about any of 5, 10, 15, or 20, including any ranges between these values) amino acids in length.
- the peptide linker comprises (and in some embodiments consists of) the amino acid sequence GGGGS.
- the first scFv is human, humanized, or semi-synthetic.
- the second scFv is human, humanized, or semi-synthetic. In some
- both the first scFv and the second scFv are human, humanized, or semisynthetic.
- tandem di-scFv bispecific anti-E7MC antibody comprising a) a first scFv that specifically binds to a complex comprising an
- HPV16-E7 peptide and an MHC class I protein comprising i) a heavy chain variable domain sequence comprising an HC-CDRl comprising the amino acid sequence of SEQ ID NO: 183, an HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 184 or 185, and an HC-
- CDR3 comprising the amino acid sequence of any one of SEQ ID NOs: 186-188; and ii) a light chain variable domain comprising an LC-CDR1 comprising the amino acid sequence of
- the first scFv is fused to the second scFv through linkage with a peptide linker.
- the peptide linker is between about 5 to about 20 (such as about any of 5, 10,
- the peptide linker comprises (and in some embodiments consists of) the amino acid sequence GGGGS.
- the first scFv is human, humanized, or semi- synthetic.
- the second scFv is human, humanized, or semi-synthetic.
- both the first scFv and the second scFv are human, humanized, or semisynthetic.
- tandem di-scFv bispecific anti-E7MC antibody comprising a) a first scFv that specifically binds to a complex comprising an
- HPV16-E7 peptide and an MHC class I protein comprising i) a heavy chain variable domain comprising an HC-CDR1 comprising the amino acid sequence of any one of SEQ ID NOs:
- HC-CDR2 comprising the amino acid sequence of any one of
- SEQ ID NOs: 78-98 or a variant thereof comprising up to about 5 (such as about any of 1, 2,
- HC-CDR3 comprising the amino acid sequence of any one of SEQ ID NOs: 99-119, 244, and 245, or a variant thereof comprising up to about 5
- an LC-CDR2 comprising the amino acid sequence of any one of SEQ ID NOs: 141-161, or a variant thereof comprising up to about 3 (such as about any of 1, 2, or 3) amino acid substitutions
- an LC-CDR3 comprising the amino acid sequence of any one of SEQ ID NOs: 162-182 and 247-250, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions
- a second scFv that specifically binds to CD3s.
- the first scFv is fused to the second scFv through linkage with a peptide linker.
- the peptide linker is between about 5 to about 20 (such as about any of 5, 10, 15, or 20, including any ranges between these values) amino acids in length. In some embodiments, the peptide linker comprises (and in some embodiments consists of) the amino acid sequence GGGGS.
- the first scFv is human, humanized, or semi- synthetic.
- the second scFv is human, humanized, or semi-synthetic. In some embodiments, both the first scFv and the second scFv are human, humanized, or semi-synthetic.
- tandem di-scFv bispecific anti-E7MC antibody comprising a) a first scFv that specifically binds to a complex comprising an
- HPV16-E7 peptide and an MHC class I protein comprising i) a heavy chain variable domain sequence comprising an HC-CDR1 comprising the amino acid sequence of any one of SEQ ID NO: 1
- the first scFv is fused to the second scFv through linkage with a peptide linker.
- the peptide linker is between about 5 to about 20 (such as about any of 5, 10, 15, or 20, including any ranges between these values) amino acids in length.
- the peptide linker comprises (and in some embodiments consists of) the amino acid sequence GGGGS.
- the first scFv is human, humanized, or semisynthetic.
- the second scFv is human, humanized, or semi-synthetic. In some embodiments, both the first scFv and the second scFv are human, humanized, or semisynthetic.
- tandem di-scFv bispecific anti-E7MC antibody comprising a) a first scFv that specifically binds to a complex comprising an
- HPV16-E7 peptide and an MHC class I protein comprising i) a heavy chain variable domain sequence comprising an HC-CDR 1 comprising the amino acid sequence of any one of SEQ ID NO: 1
- LC-CDR1 comprising the amino acid sequence of any one of SEQ ID NOs: 120-140 and
- the first scFv is fused to the second scFv through linkage with a peptide linker.
- the peptide linker is between about 5 to about 20 (such as about any of 5, 10,
- the peptide linker comprises (and in some embodiments consists of) the amino acid sequence GGGGS.
- the first scFv is human, humanized, or semi- synthetic.
- the second scFv is human, humanized, or semi-synthetic.
- both the first scFv and the second scFv are human, humanized, or semisynthetic.
- tandem di-scFv bispecific anti-E7MC antibody comprising a) a first scFv comprising a heavy chain variable domain comprising the amino acid sequence of any one of SEQ ID NOs: 15-35 and 233-237, or a variant thereof having at least about 95% (for example at least about any of 96%, 97%, 98%, or 99%) sequence identity, and a light chain variable domain comprising the amino acid sequence of any one of SEQ ID NOs: 36-56 and 238-243, or a variant thereof having at least about 95% (for example at least about any of 96%, 97%, 98%, or 99%) sequence identity, and b) a second scFv that specifically binds to CD3s.
- the first scFv is fused to the second scFv through linkage with a peptide linker.
- the peptide linker is between about 5 to about 20 (such as about any of 5, 10, 15, or 20, including any ranges between these values) amino acids in length.
- the peptide linker comprises (and in some embodiments consists of) the amino acid sequence GGGGS.
- the first scFv is human, humanized, or semi- synthetic.
- the second scFv is human, humanized, or semi-synthetic. In some embodiments, both the first scFv and the second scFv are human, humanized, or semi-synthetic.
- tandem di-scFv bispecific anti-E7MC antibody comprising a) a first scFv comprising a heavy chain variable domain comprising the amino acid sequence of any one of SEQ ID NOs: 15-35 and 233-237 and a light chain variable domain comprising the amino acid sequence of any one of SEQ ID NOs: 36-56 and 238-243, and b) a second scFv that specifically binds to CD3s.
- the first scFv is fused to the second scFv through linkage with a peptide linker.
- the peptide linker is between about 5 to about 20 (such as about any of 5, 10, 15, or 20, including any ranges between these values) amino acids in length. In some embodiments, the peptide linker comprises (and in some embodiments consists of) the amino acid sequence GGGGS.
- the first scFv is human, humanized, or semisynthetic.
- the second scFv is human, humanized, or semi-synthetic. In some embodiments, both the first scFv and the second scFv are human, humanized, or semisynthetic.
- the tandem di-scFv bispecific anti-E7MC antibody binds to a complex comprising an HPV16-E7 peptide and an MHC class I protein with a K d between about 0.1 M to about 500 nM (such as about any of 0.1 pM, 1.0 pM, 10 pM, 50 pM, 100 pM, 500 pM, 1 nM, 10 nM, 50 nM, 100 nM, or 500 nM, including any ranges between these values).
- the tandem di-scFv bispecific anti-E7MC antibody binds to a complex comprising an HPV16-E7 peptide and an MHC class I protein with a K d between about 1 nM to about 500 nM (such as about any of 1, 10, 25, 50, 75, 100, 150, 200, 250, 300, 350, 400, 450, or 500 nM, including any ranges between these values).
- the anti-E7MC construct in some embodiments is a chimeric antigen receptor (CAR) comprising an anti-E7MC antibody moiety (also referred to herein as an "anti-E7MC CAR").
- CAR chimeric antigen receptor
- anti-E7MC CAR an anti-E7MC antibody moiety
- a CAR effector cell e.g. , T cell
- an anti-E7MC CAR effector cell also referred to herein as an "anti-E7MC CAR effector cell"
- the anti-E7MC CAR comprises a) an extracellular domain comprising an anti- E7MC antibody moiety that specifically binds to a complex comprising an HPV16-E7 peptide and an MHC class I protein and b) an intracellular signaling domain.
- transmembrane domain may be present between the extracellular domain and the intracellular domain.
- the spacer domain can be any oligo- or polypeptide that functions to link the transmembrane domain to the extracellular domain or the intracellular domain in the polypeptide chain.
- a spacer domain may comprise up to about 300 amino acids, including for example about 10 to about 100, or about 25 to about 50 amino acids.
- the transmembrane domain may be derived either from a natural or from a synthetic source. Where the source is natural, the domain may be derived from any membrane-bound or transmembrane protein.
- Transmembrane regions of particular use in this invention may be derived from (i.e. comprise at least the transmembrane region(s) of) the a, ⁇ , ⁇ , ⁇ , or ⁇ chain of the T-cell receptor, CD28, CD3s, ⁇ 3 ⁇ , CD45, CD4, CD5, CD8, CD9, CD16, CD22, CD33, CD37, CD64, CD80, CD86, CD134, CD137, or CD154.
- the transmembrane domain may be synthetic, in which case it may comprise predominantly hydrophobic residues such as leucine and valine.
- a triplet of phenylalanine, tryptophan and valine may be found at each end of a synthetic transmembrane domain.
- a short oligo- or polypeptide linker having a length of, for example, between about 2 and about 10 (such as about any of 2, 3, 4, 5, 6, 7, 8, 9, or 10) amino acids in length may form the linkage between the transmembrane domain and the intracellular signaling domain of the anti-E7MC CAR.
- the linker is a glycine- serine doublet.
- the transmembrane domain that naturally is associated with one of the sequences in the intracellular domain of the anti-E7MC CAR is used (e.g. , if an anti-E7MC CAR intracellular domain comprises a CD28 co-stimulatory sequence, the transmembrane domain of the anti-E7MC CAR is derived from the CD28 transmembrane domain).
- the transmembrane domain can be selected or modified by amino acid substitution to avoid binding of such domains to the transmembrane domains of the same or different surface membrane proteins to minimize interactions with other members of the receptor complex.
- the intracellular signaling domain of the anti-E7MC CAR is responsible for activation of at least one of the normal effector functions of the immune cell in which the anti-E7MC CAR has been placed in.
- Effector function of a T cell for example, may be cytolytic activity or helper activity including the secretion of cytokines.
- intracellular signaling domain refers to the portion of a protein which transduces the effector function signal and directs the cell to perform a specialized function. While usually the entire intracellular signaling domain can be employed, in many cases it is not necessary to use the entire chain. To the extent that a truncated portion of the intracellular signaling domain is used, such truncated portion may be used in place of the intact chain as long as it transduces the effector function signal.
- intracellular signaling sequence is thus meant to include any truncated portion of the intracellular signaling domain sufficient to transduce the effector function signal.
- intracellular signaling domains for use in the anti-E7MC CAR of the invention include the cytoplasmic sequences of the T cell receptor (TCR) and co-receptors that act in concert to initiate signal transduction following antigen receptor engagement, as well as any derivative or variant of these sequences and any synthetic sequence that has the same functional capability.
- TCR T cell receptor
- co-receptors that act in concert to initiate signal transduction following antigen receptor engagement
- T cell activation can be said to be mediated by two distinct classes of intracellular signaling sequence: those that initiate antigen-dependent primary activation through the TCR (primary signaling sequences) and those that act in an antigen-independent manner to provide a secondary or co-stimulatory signal (co-stimulatory signaling sequences).
- Primary signaling sequences regulate primary activation of the TCR complex either in a stimulatory way, or in an inhibitory way.
- Primary signaling sequences that act in a stimulatory manner may contain signaling motifs which are known as immunoreceptor tyrosine-based activation motifs or ITAMs.
- ITAMs immunoreceptor tyrosine-based activation motifs
- the anti-E7MC CAR constructs in some embodiments comprise one or more ITAMs.
- IT AM containing primary signaling sequences examples include those derived from TCR ⁇ , FcRy, FcRp, CD3y, CD35, CD3s, CD5, CD22, CD79a, CD79b, and CD66d.
- the anti-E7MC CAR comprises a primary signaling sequence derived from CD3 ⁇ .
- the intracellular signaling domain of the CAR can comprise the CD3 ⁇ intracellular signaling sequence by itself or combined with any other desired intracellular signaling sequence(s) useful in the context of the anti-E7MC CAR of the invention.
- the intracellular domain of the anti-E7MC CAR can comprise a CD3 ⁇ intracellular signaling sequence and a costimulatory signaling sequence.
- the costimulatory signaling sequence can be a portion of the intracellular domain of a
- costimulatory molecule including, for example, CD27, CD28, 4-1BB (CD137), OX40, CD30, CD40, PD-1, ICOS, lymphocyte function-associated antigen-1 (LFA-1), CD2, CD7, LIGHT, NKG2C, B7-H3, a ligand that specifically binds with CD83, and the like.
- the intracellular signaling domain of the anti-E7MC CAR comprises the intracellular signaling sequence of CD3 ⁇ and the intracellular signaling sequence of CD28. In some embodiments, the intracellular signaling domain of the anti- E7MC CAR comprises the intracellular signaling sequence of CD3 ⁇ and the intracellular signaling sequence of 4- IBB. In some embodiments, the intracellular signaling domain of the anti-E7MC CAR comprises the intracellular signaling sequence of CD3 ⁇ and the intracellular signaling sequences of CD28 and 4- IBB.
- an anti-E7MC CAR comprising a) an extracellular domain comprising an anti-E7MC antibody moiety that specifically binds to a complex comprising an HPV16-E7 peptide and an MHC class I protein, b) a transmembrane domain, and c) an intracellular signaling domain.
- the HPV16-E7 peptide is HPV16-E7 11-19 (SEQ ID NO: 4).
- the MHC class I protein is HLA-A02.
- the MHC class I protein is HLA-A*02:01.
- the intracellular signaling domain is capable of activating an immune cell.
- the intracellular signaling domain comprises a primary signaling sequence and a co- stimulatory signaling sequence.
- the primary signaling sequence comprises a CD3 ⁇ intracellular signaling sequence.
- the co- stimulatory signaling sequence comprises a CD28 intracellular signaling sequence.
- the intracellular domain comprises a CD3 ⁇ intracellular signaling sequence and a CD28 intracellular signaling sequence.
- the anti-E7MC antibody moiety cross-reacts with at least one (such as at least any of 2, 3, 4, 5, or 6) complex comprising the MHC class I protein and a variant of the HPV16-E7 peptide having one amino acid substitution (such as a conservative amino acid substitution).
- the anti-E7MC antibody moiety cross-reacts with at least one (such as at least any of 2, 3, 4, or 5) complex comprising the HPV16-E7 peptide and a different subtype of the MHC class I protein.
- an anti-E7MC CAR comprising a) an extracellular domain comprising an anti-E7MC antibody moiety that specifically binds to a complex comprising an HPV16-E7 11-19 peptide (SEQ ID NO: 4) and HLA-A*02:01, b) a transmembrane domain, and c) an intracellular signaling domain.
- the intracellular signaling domain is capable of activating an immune cell.
- the intracellular signaling domain comprises a primary signaling sequence and a co- stimulatory signaling sequence.
- the primary signaling sequence comprises a CD3 ⁇ intracellular signaling sequence.
- the co-stimulatory signaling sequence comprises a CD28 intracellular signaling sequence.
- the intracellular domain comprises a CD3 ⁇ intracellular signaling sequence and a CD28 intracellular signaling sequence.
- an anti-E7MC CAR comprising a) an extracellular domain comprising an anti-E7MC antibody moiety that specifically binds to a complex comprising an HPV16-E7 peptide and an MHC class I protein comprising i) a heavy chain variable domain sequence comprising an HC-CDR1 comprising the amino acid sequence of SEQ ID NO: 183, or a variant thereof comprising up to about 3 (for example about any of 1, 2, or 3) amino acid substitutions, an HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 184 or 185, or a variant thereof comprising up to about 3 (for example about any of 1, 2, or 3) amino acid substitutions, and an HC-CDR3 comprising the amino acid sequence of any one of SEQ ID NOs: 186-188, or a variant thereof comprising up to about 3 (for example about any of 1, 2, or 3) amino acid substitutions; and ii) a light chain variable domain comprising an LC
- ID NO: 191 or a variant thereof comprising up to about 3 (for example about any of 1, 2, or
- the intracellular signaling domain is capable of activating an immune cell.
- the intracellular signaling domain comprises a primary signaling sequence and a co-stimulatory signaling sequence.
- the primary signaling sequence comprises a CD3 ⁇ intracellular signaling sequence.
- the co-stimulatory signaling sequence comprises a CD28 intracellular signaling sequence.
- the intracellular domain comprises a CD3 ⁇ intracellular signaling sequence and a CD28 intracellular signaling sequence.
- an anti-E7MC CAR comprising a) an extracellular domain comprising an anti-E7MC antibody moiety that specifically binds to a complex comprising an HPV16-E7 peptide and an MHC class I protein comprising i) a heavy chain variable domain sequence comprising an HC-CDR1 comprising the amino acid sequence of SEQ ID NO: 183, an HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 183, an HC-CDR2 comprising the amino acid sequence of SEQ ID
- a light chain variable domain comprising an LC-CDR1 comprising the amino acid sequence of SEQ ID NO: 189 or 190, and an LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 191; b) an intracellular signaling domain.
- the intracellular signaling domain is capable of activating an immune cell.
- the intracellular signaling domain comprises a primary signaling sequence and a co-stimulatory signaling sequence.
- the primary signaling sequence comprises a CD3 ⁇ intracellular signaling sequence.
- the co-stimulatory signaling sequence comprises a CD28 intracellular signaling sequence.
- the intracellular domain comprises a CD3 ⁇ intracellular signaling sequence and a CD28 intracellular signaling sequence.
- an anti-E7MC CAR comprising a) an extracellular domain comprising an anti-E7MC antibody moiety that specifically binds to a complex comprising an HPV16-E7 peptide and an MHC class I protein comprising i) a heavy chain variable domain comprising an HC-CDR1 comprising the amino acid sequence of any one of SEQ ID NOs: 57-77, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions, an HC-CDR2 comprising the amino acid sequence of any one of SEQ ID NOs: 78-98, or a variant thereof comprising up to about 5
- an HC-CDR3 comprising the amino acid sequence of any one of SEQ ID NOs: 99-119, 244, and 245, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid
- a light chain variable domain comprising an LC-CDR1 comprising the amino acid sequence of any one of SEQ ID NOs: 120-140 and 246, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions, an
- LC-CDR2 comprising the amino acid sequence of any one of SEQ ID NOs: 141-161, or a variant thereof comprising up to about 3 (such as about any of 1, 2, or 3) amino acid substitutions
- an LC-CDR3 comprising the amino acid sequence of any one of SEQ ID NOs: 141-161, or a variant thereof comprising up to about 3 (such as about any of 1, 2, or 3) amino acid substitutions
- an LC-CDR3 comprising the amino acid sequence of any one of SEQ ID
- the intracellular signaling domain is capable of activating an immune cell.
- the intracellular signaling domain comprises a primary signaling sequence and a co-stimulatory signaling sequence.
- the primary signaling sequence comprises a CD3 ⁇ intracellular signaling sequence.
- the co- stimulatory signaling sequence comprises a CD28 intracellular signaling sequence.
- the intracellular domain comprises a
- CD3 ⁇ intracellular signaling sequence and a CD28 intracellular signaling sequence are CD3 ⁇ intracellular signaling sequence and a CD28 intracellular signaling sequence.
- an anti-E7MC CAR comprising a) an extracellular domain comprising an anti-E7MC antibody moiety that specifically binds to a complex comprising an HPV16-E7 peptide and an MHC class I protein comprising i) a heavy chain variable domain sequence comprising an HC-CDR1 comprising the amino acid sequence of any one of SEQ ID NOs: 57-77; an HC-CDR2 comprising the amino acid sequence of any one of SEQ ID NOs: 78-98; and an HC-CDR3 comprising the amino acid sequence of any one of SEQ ID NOs: 99-119, 244, and 245; or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions in the HC-CDR sequences; and ii) a light chain variable domain sequence comprising an LC-CDR1 comprising the amino acid sequence of any one of SEQ ID NOs: 120-140 and 246; an extracellular domain comprising an anti-E7MC
- CDR2 comprising the amino acid sequence of any one of SEQ ID NOs: 141-161; and an LC- CDR3 comprising the amino acid sequence of any one of SEQ ID NOs: 162-182 and 247-
- the intracellular signaling domain is capable of activating an immune cell.
- the intracellular signaling domain comprises a primary signaling sequence and a co-stimulatory signaling sequence.
- the primary signaling sequence comprises a CD3 ⁇ intracellular signaling sequence.
- the co- stimulatory signaling sequence comprises a CD28 intracellular signaling sequence.
- the intracellular domain comprises a
- CD3 ⁇ intracellular signaling sequence and a CD28 intracellular signaling sequence are CD3 ⁇ intracellular signaling sequence and a CD28 intracellular signaling sequence.
- an anti-E7MC CAR comprising a) an extracellular domain comprising an anti-E7MC antibody moiety that specifically binds to a complex comprising an HPV16-E7 peptide and an MHC class I protein comprising i) a heavy chain variable domain sequence comprising an HC-CDR1 comprising the amino acid sequence of any one of SEQ ID NOs: 57-77; an HC-CDR2 comprising the amino acid sequence of any one of SEQ ID NOs: 78-98; and an HC-CDR3 comprising the amino acid sequence of any one of SEQ ID NOs: 99-119, 244, and 245; and ii) a light chain variable domain sequence comprising an LC-CDR1 comprising the amino acid sequence of any one of SEQ ID NOs: 120-140 and 246; an LC-CDR2 comprising the amino acid sequence of any one of SEQ ID NOs: 141-161; and an LC-CDR3 comprising the
- the intracellular signaling domain is capable of activating an immune cell.
- the intracellular signaling domain comprises a primary signaling sequence and a co-stimulatory signaling sequence.
- the primary signaling sequence comprises a CD3 ⁇ intracellular signaling sequence.
- the co-stimulatory signaling sequence comprises a CD28 intracellular signaling sequence.
- the intracellular domain comprises a CD3 ⁇ intracellular signaling sequence and a CD28 intracellular signaling sequence.
- an anti-E7MC CAR comprising a) an extracellular domain comprising an anti-E7MC antibody moiety that specifically binds to a complex comprising an HPV16-E7 peptide and an MHC class I protein comprising a heavy chain variable domain comprising the amino acid sequence of any one of SEQ ID NOs: 15-
- the intracellular signaling domain is capable of activating an immune cell.
- the intracellular signaling domain comprises a primary signaling sequence and a co-stimulatory signaling sequence.
- the primary signaling sequence comprises a CD3 ⁇ intracellular signaling sequence.
- the co-stimulatory signaling sequence comprises a CD28 intracellular signaling sequence.
- the intracellular domain comprises a CD3 ⁇ intracellular signaling sequence and a CD28 intracellular signaling sequence.
- an anti-E7MC CAR comprising a) an extracellular domain comprising an anti-E7MC antibody moiety that specifically binds to a complex comprising an HPV16-E7 peptide and an MHC class I protein comprising a heavy chain variable domain comprising the amino acid sequence of any one of SEQ ID NOs: 15-
- the intracellular signaling domain is capable of activating an immune cell.
- the intracellular signaling domain comprises a primary signaling sequence and a co-stimulatory signaling sequence.
- the primary signaling sequence comprises a CD3 ⁇ intracellular signaling sequence.
- the co-stimulatory signaling sequence comprises a CD28 intracellular signaling sequence.
- the intracellular domain comprises a CD3 ⁇ intracellular signaling sequence and a CD28 intracellular signaling sequence.
- an anti-E7MC CAR comprising a) an extracellular domain comprising an anti-E7MC antibody moiety that specifically binds to a complex comprising an HPV16-E7 peptide and an MHC class I protein, b) a transmembrane domain, and c) an intracellular signaling domain comprising a CD3 ⁇ intracellular signaling sequence and a CD28 intracellular signaling sequence.
- the HPV16-E7 peptide is HPV16-E7 11-19 (SEQ ID NO: 4).
- the MHC class I protein is HLA-A02. In some embodiments, the MHC class I protein is HLA-A*02:01.
- an anti-E7MC CAR comprising a) an extracellular domain comprising an anti-E7MC antibody moiety that specifically binds to a complex comprising an HPV16-E7 11-19 peptide (SEQ ID NO: 4) and HLA-A*02:01, b) a transmembrane domain, and c) an intracellular signaling domain comprising a CD3 ⁇ intracellular signaling sequence and a CD28 intracellular signaling sequence.
- an anti-E7MC CAR comprising a) an extracellular domain comprising an anti-E7MC antibody moiety that specifically binds to a complex comprising an HPV16-E7 peptide and an MHC class I protein comprising i) a heavy chain variable domain sequence comprising an HC-CDR1 comprising the amino acid sequence of SEQ ID NO: 183, or a variant thereof comprising up to about 3 (for example about any of 1, 2, or 3) amino acid substitutions, an HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 184 or 185, or a variant thereof comprising up to about 3 (for example about any of 1, 2, or 3) amino acid substitutions, and an HC-CDR3 comprising the amino acid sequence of any one of SEQ ID NOs: 186-188, or a variant thereof comprising up to about 3 (for example about any of 1, 2, or 3) amino acid substitutions; and ii) a light chain variable domain comprising an LC
- an anti-E7MC CAR comprising a) an extracellular domain comprising an anti-E7MC antibody moiety that specifically binds to a complex comprising an HPV16-E7 peptide and an MHC class I protein comprising i) a heavy chain variable domain sequence comprising an HC-CDR1 comprising the amino acid sequence of SEQ ID NO: 183, an HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 184 or 185, and an HC-CDR3 comprising the amino acid sequence of any one of SEQ ID NOs: 186-188; and ii) a light chain variable domain comprising an LC-CDR1 comprising the amino acid sequence of SEQ ID NO: 189 or 190, and an LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 191, b) a transmembrane domain, and c) an intracellular signaling domain comprising a CD3 ⁇ intracellular signaling sequence and a
- an anti-E7MC CAR comprising a) an extracellular domain comprising an anti-E7MC antibody moiety that specifically binds to a complex comprising an HPV16-E7 peptide and an MHC class I protein comprising i) a heavy chain variable domain comprising an HC-CDR1 comprising the amino acid sequence of any one of SEQ ID NOs: 57-77, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions, an HC-CDR2 comprising the amino acid sequence of any one of SEQ ID NOs: 78-98, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions, and an HC-CDR3 comprising the amino acid sequence of any one of SEQ ID NOs: 99-119, 244, and 245, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid
- a light chain variable domain comprising an LC-CDR1 comprising the amino acid sequence of any one of SEQ ID NOs: 120-140 and 246, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions, an LC-CDR2 comprising the amino acid sequence of any one of SEQ ID NOs: 141-161, or a variant thereof comprising up to about 3 (such as about any of 1, 2, or 3) amino acid substitutions, and an LC-CDR3 comprising the amino acid sequence of any one of SEQ ID NOs: 162-182 and 247-250, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions; b) a transmembrane domain, and c) an intracellular signaling domain comprising a CD3 ⁇ intracellular signaling sequence and a CD28 intracellular signaling sequence.
- an anti-E7MC CAR comprising a) an extracellular domain comprising an anti-E7MC antibody moiety that specifically binds to a complex comprising an HPV16-E7 peptide and an MHC class I protein comprising i) a heavy chain variable domain sequence comprising an HC-CDR1 comprising the amino acid sequence of any one of SEQ ID NOs: 57-77; an HC-CDR2 comprising the amino acid sequence of any one of SEQ ID NOs: 78-98; and an HC-CDR3 comprising the amino acid sequence of any one of SEQ ID NOs: 99-119, 244, and 245; or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions in the HC-CDR sequences; and ii) a light chain variable domain sequence comprising an LC-CDR1 comprising the amino acid sequence of any one of SEQ ID NOs: 120-140 and 246; an extracellular domain comprising an anti-E7MC
- an anti-E7MC CAR comprising a) an extracellular domain comprising an anti-E7MC antibody moiety that specifically binds to a complex comprising an HPV16-E7 peptide and an MHC class I protein comprising i) a heavy chain variable domain sequence comprising an HC-CDR1 comprising the amino acid sequence of any one of SEQ ID NOs: 57-77; an HC-CDR2 comprising the amino acid sequence of any one of SEQ ID NOs: 78-98; and an HC-CDR3 comprising the amino acid sequence of any one of SEQ ID NOs: 99-119, 244, and 245; and ii) a light chain variable domain sequence comprising an LC-CDR1 comprising the amino acid sequence of any one of SEQ ID NOs: 120-140 and 246; an LC-CDR2 comprising the amino acid sequence of any one of SEQ ID NOs: 141-161; and an LC-CDR3 comprising the
- an anti-E7MC CAR comprising a) an extracellular domain comprising an anti-E7MC antibody moiety that specifically binds to a complex comprising an HPV16-E7 peptide and an MHC class I protein comprising i) a heavy chain variable domain comprising the amino acid sequence of any one of SEQ ID NOs: 15- 35 and 233-237, or a variant thereof having at least about 95% (for example at least about any of 96%, 97%, 98%, or 99%) sequence identity, and a light chain variable domain comprising the amino acid sequence of any one of SEQ ID NOs: 36-56 and 238-243, or a variant thereof having at least about 95% (including for example at least about any of 96%, 97%, 98%, or 99%) sequence identity; b) a transmembrane domain, and c) an intracellular signaling domain comprising a CD3 ⁇ intracellular signaling sequence and a CD28 intracellular signaling sequence.
- an anti-E7MC CAR comprising a) an extracellular domain comprising an anti-E7MC antibody moiety that specifically binds to a complex comprising an HPV16-E7 peptide and an MHC class I protein comprising a heavy chain variable domain comprising the amino acid sequence of any one of SEQ ID NOs: 15- 35 and 233-237 and a light chain variable domain comprising the amino acid sequence of any one of SEQ ID NOs: 36-56 and 238-243; b) a transmembrane domain, and c) an intracellular signaling domain comprising a CD3 ⁇ intracellular signaling sequence and a CD28
- effector cells such as lymphocytes, e.g., T cells
- effector cells expressing an anti-E7MC CAR.
- Also provided is a method of producing an effector cell expressing an anti-E7MC CAR comprising introducing a vector comprising a nucleic acid encoding the anti-E7MC CAR into the effector cell.
- introducing the vector into the effector cell comprises transducing the effector cell with the vector.
- introducing the vector into the effector cell comprises transfecting the effector cell with the vector. Transduction or transfection of the vector into the effector cell can be carried about using any method known in the art.
- the anti-E7MC constructs in some embodiments comprise an immunoconjugate comprising an anti-E7MC antibody moiety attached to an effector molecule (also referred to herein as an "anti-E7MC immunoconjugate").
- an effector molecule also referred to herein as an "anti-E7MC immunoconjugate”
- the effector molecule is a therapeutic agent, such as a cancer therapeutic agent, which is either cytotoxic, cytostatic or otherwise provides some therapeutic benefit.
- the effector molecule is a label, which can generate a detectable signal, either directly or indirectly.
- an anti-E7MC immunoconjugate comprising an anti-E7MC antibody moiety and a therapeutic agent (also referred to herein as an "antibody-drug conjugate", or "ADC").
- the therapeutic agent is a toxin that is either cytotoxic, cytostatic or otherwise prevents or reduces the ability of the target cells to divide.
- ADCs for the local delivery of cytotoxic or cytostatic agents, i.e., drugs to kill or inhibit tumor cells in the treatment of cancer (Syrigos and Epenetos, Anticancer Research 19:605-614 (1999); Niculescu-Duvaz and Springer, Adv. Org. Del. Rev.
- Therapeutic agents used in anti-E7MC immunoconjugates include, for example, daunomycin, doxorubicin, methotrexate, and vindesine (Rowland et al. , Cancer Immunol. Immunother. 21: 183-187 (1986)).
- Toxins used in anti-E7MC immunoconjugates include bacterial toxins such as diphtheria toxin, plant toxins such as ricin, small molecule toxins such as geldanamycin (Mandler et al, J.Nat. Cancer Inst. 92(19): 1573-1581 (2000); Mandler et al., Bioorganic & Med. Chem.
- cytotoxic drugs may exert their cytotoxic and cytostatic effects by mechanisms including tubulin binding, DNA binding, or topoisomerase inhibition. Some cytotoxic drugs tend to be inactive or less active when conjugated to large antibodies or protein receptor ligands.
- Enzymatically active toxins and fragments thereof that can be used include, for example, diphtheria A chain, nonbinding active fragments of diphtheria toxin, exotoxin A chain (from Pseudomonas aeruginosa), ricin A chain, abrin A chain, modeccin A chain,a- sarcin, Aleurites fordii proteins, dianthin proteins, Phytolaca americana proteins (PAPI, PAPII, and PAP-S), momordica charantia inhibitor, curcin, crotin, sapaonaria officinalis inhibitor, gelonin, mitogellin, restrictocin, phenomycin, enomycin, and the tricothecenes. See, e.g., WO 93/21232 published October 28, 1993.
- Anti-E7MC immunoconjugates of an anti-E7MC antibody moiety and one or more small molecule toxins are also contemplated herein.
- small molecule toxins such as a calicheamicin, maytansinoids, dolastatins, aurostatins, a trichothecene, and CC1065, and the derivatives of these toxins that have toxin activity, are also contemplated herein.
- an anti-E7MC immunoconjugate comprising a therapeutic agent that has an intracellular activity.
- the anti-E7MC immunoconjugate is internalized and the therapeutic agent is a cytotoxin that blocks the protein synthesis of the cell, therein leading to cell death.
- the therapeutic agent is a cytotoxin comprising a polypeptide having ribosome-inactivating activity including, for example, gelonin, bouganin, saporin, ricin, ricin A chain, bryodin, diphtheria toxin, restrictocin, Pseudomonas exotoxin A and variants thereof.
- the anti-E7MC immunoconjugate must be internalized upon binding to the target cell in order for the protein to be cytotoxic to the cells.
- an anti-E7MC immunoconjugate comprising a therapeutic agent that acts to disrupt DNA.
- the therapeutic agent that acts to disrupt DNA is, for example, selected from the group consisting of enediyne (e.g. , calicheamicin and esperamicin) and non-enediyne small molecule agents (e.g. , bleomycin, methidiumpropyl-EDTA-Fe(II)).
- cancer therapeutic agents useful in accordance with the present application include, without limitation, daunorubicin, doxorubicin, distamycin A, cisplatin, mitomycin C, ecteinascidins, duocarmycin/CC-1065, and bleomycin/pepleomycin.
- the present invention further contemplates an anti-E7MC immunoconjugate formed between the anti-E7MC antibody moiety and a compound with nucleolytic activity (e.g. , a ribonuclease or a DNA endonuclease such as a deoxyribonuclease; DNase).
- a compound with nucleolytic activity e.g. , a ribonuclease or a DNA endonuclease such as a deoxyribonuclease; DNase.
- the anti-E7MC immunoconjugate comprises an agent that acts to disrupt tubulin.
- agents may include, for example, rhizoxin/maytansine, paclitaxel, vincristine and vinblastine, colchicine, auristatin dolastatin 10 MMAE, and peloruside A.
- the anti-E7MC immunoconjugate comprises an alkylating agent including, for example, Asaley NSC 167780, AZQ NSC 182986, BCNU NSC 409962,
- Busulfan NSC 750 carboxyphthalatoplatinum NSC 271674, CBDCA NSC 241240, CCNU
- NSC 95441 mitomycin C NSC 26980, mitozolamide NSC 353451 , nitrogen mustard NSC
- NSC 296934 tetraplatin NSC 363812, thio-tepa NSC 6396, triethylenemelamine NSC 9706, uracil nitrogen mustard NSC 34462, and Yoshi-864 NSC 102627.
- the cancer therapeutic agent portion of the anti-E7MC immunoconjugate of the present application may comprise an antimitotic agent including, without limitation, allocolchicine NSC 406042, Halichondrin B NSC 609395, colchicine NSC 757, colchicine derivative NSC 33410, dolastatin 10 NSC 376128 (NG - auristatin derived), maytansine NSC 153858, rhizoxin NSC 332598, taxol NSC 125973, taxol derivative NSC 608832, thiocolchicine NSC 361792, trityl cysteine NSC 83265, vinblastine sulfate NSC 49842, and vincristine sulfate NSC 67574.
- an antimitotic agent including, without limitation, allocolchicine NSC 406042, Halichondrin B NSC 609395, colchicine NSC 757, colchicine derivative NSC 33410, dolastatin 10 NSC 376128 (NG -
- the anti-E7MC immunoconjugate comprises a topoisomerase
- camptothecin NSC 94600 camptothecin, Na salt NSC 100880, aminocamptothecin NSC 603071 , camptothecin derivative NSC 95382, camptothecin derivative NSC 107124, camptothecin derivative NSC 643833, camptothecin derivative NSC 629971 , camptothecin derivative NSC 295500, camptothecin derivative NSC 249910, camptothecin derivative NSC 606985, camptothecin derivative NSC 374028, camptothecin derivative NSC 176323, camptothecin derivative NSC 295501 , camptothecin derivative NSC 606172, camptothecin derivative NSC 606173, camptothecin derivative NSC 610458, camptothecin derivative NSC 618939, camptothecin derivative NSC 610457, camptothecin derivative NSC 610459, camptothecin derivative NSC 606499, camptothecin
- the anti-E7MC immunoconjugate comprises a topoisomerase
- doxorubicin NSC 123127 amonafide NSC 308847, m-AMSA NSC 249992, anthrapyrazole derivative NSC 355644, pyrazoloacridine NSC 366140, bisantrene HCL NSC 337766, daunorubicin NSC 82151 , deoxydoxorubicin NSC 267469, mitoxantrone NSC 301739, menogaril NSC 269148, ⁇ , ⁇ -dibenzyl daunomycin NSC 268242, oxanthrazole NSC 349174, rubidazone NSC 164011 , VM-26 NSC 122819, and VP-16 NSC 141540.
- the anti-E7MC immunoconjugate comprises an RNA or
- DNA antimetabolite including, without limitation, L-alanosine NSC 153353, 5-azacytidine
- NSC 102816 5-fluorouracil NSC 19893, acivicin NSC 163501 , aminopterin derivative NSC
- aminopterin derivative NSC 184692 aminopterin derivative NSC 134033, an antifol
- NSC 633713 an antifol NSC 623017, Baker's soluble antifol NSC 139105, dichlorallyl lawsone NSC 126771 , brequinar NSC 368390, ftorafur (pro-drug) NSC 148958, 5,6- dihydro-5-azacytidine NSC 264880, methotrexate NSC 740, methotrexate derivative NSC
- N-(phosphonoacetyl)-L-aspartate (PALA) NSC 224131 N-(phosphonoacetyl)-L-aspartate (PALA) NSC 224131 , pyrazofurin NSC 143095, trimetrexate NSC 352122, 3-HP NSC 95678, 2'-deoxy-5-fluorouridine NSC 27640, 5-HP
- the anti-E7MC immunoconjugate comprises a highly radioactive atom.
- a variety of radioactive isotopes are available for the production of radioconjugated antibodies. Examples include 211 At, 131 I, 125 I, 90 Y, 186 Re, 188 Re, 153 Sm, 212 Bi,
- the anti-E7MC antibody moiety can be conjugated to a "receptor” (such as streptavidin) for utilization in tumor pre-targeting wherein the antibody- receptor conjugate is administered to the patient, followed by removal of unbound conjugate from the circulation using a clearing agent and then administration of a "ligand” (e.g., avidin) that is conjugated to a cytotoxic agent (e.g., a radionucleotide).
- a "receptor” such as streptavidin
- a ligand e.g., avidin
- cytotoxic agent e.g., a radionucleotide
- an anti-E7MC immunoconjugate may comprise an anti- E7MC antibody moiety conjugated to a prodrug-activating enzyme. In some such
- a prodrug-activating enzyme converts a prodrug (e.g. , a peptidyl
- chemotherapeutic agent see WO 81/01145
- an active drug such as an anti-cancer drug.
- anti-E7MC immunoconjugates are useful, in some embodiments, in antibody-dependent enzyme-mediated prodrug therapy ("ADEPT").
- Enzymes that may be conjugated to an antibody include, but are not limited to, alkaline phosphatases, which are useful for converting phosphate-containing prodrugs into free drugs; arylsulfatases, which are useful for converting sulfate-containing prodrugs into free drugs; cytosine deaminase, which is useful for converting non-toxic 5-fluorocytosine into the anti-cancer drug, 5-fluorouracil; proteases, such as serratia protease, thermolysin, subtilisin, carboxypeptidases and cathepsins (such as cathepsins B and L), which are useful for converting peptide-containing prodrugs into free drugs; D-alanylcarboxypeptidases, which are useful for converting prodrugs that contain D- amino acid substituents; carbohydrate-cleaving enzymes such as ⁇ -galactosidase and neuraminidase, which are useful for converting glycosylated
- the therapeutic portion of the anti-E7MC immunoconjugates may be a nucleic acid.
- Nucleic acids that may be used include, but are not limited to, anti- sense RNA, genes or other polynucleotides, including nucleic acid analogs such as thioguanine and thiopurine.
- the present application further provides anti-E7MC immunoconjugates comprising an anti-E7MC antibody moiety attached to an effector molecule, wherein the effector molecule is a label, which can generate a detectable signal, indirectly or directly.
- These anti- E7MC immunoconjugates can be used for research or diagnostic applications, such as for the in vivo detection of cancer.
- the label is preferably capable of producing, either directly or indirectly, a detectable signal.
- the label may be radio-opaque or a radioisotope, such as 3 H, 14 C, 32 P, 35 S, 123 I, 125 I, 131 I; a fluorescent (fluorophore) or chemiluminescent (chromophore) compound, such as fluorescein isothiocyanate, rhodamine or luciferin; an enzyme, such as alkaline phosphatase,P-galactosidase or horseradish peroxidase; an imaging agent; or a metal ion.
- a radioisotope such as 3 H, 14 C, 32 P, 35 S, 123 I, 125 I, 131 I
- a fluorescent (fluorophore) or chemiluminescent (chromophore) compound such as fluorescein isothiocyanate, rhodamine or luciferin
- an enzyme such as alkaline phosphatase,P-galactosidase or horseradish
- the label is a radioactive atom for scintigraphic studies, for example 99 Tc or 123 I, or a spin label for nuclear magnetic resonance (NMR) imaging (also known as magnetic resonance imaging, MRI), such as zirconium-89, iodine-
- NMR nuclear magnetic resonance
- MRI magnetic resonance imaging
- Zirconium-89 may be complexed to various metal chelating agents and conjugated to antibodies, e.g., for PET imaging (WO 2011/056983).
- the anti-E7MC immunoconjugate is detectable indirectly.
- a secondary antibody that is specific for the anti-E7MC immunoconjugate and contains a detectable label can be used to detect the anti-E7MC immunoconjugate.
- an anti-E7MC immunoconjugate comprising a) an anti-E7MC antibody moiety that specifically binds to a complex comprising an HPV16-E7 peptide and an MHC class I protein, and b) an effector molecule.
- the HPV16-E7 peptide is HPV16-E7 11-19 (SEQ ID NO:
- the MHC class I protein is HLA-A02. In some embodiments, the
- MHC class I protein is HLA-A*02:01.
- the effector molecule is covalently attached to the anti-E7MC antibody moiety.
- the effector molecule is a therapeutic agent selected, for example, from the group consisting of a drug, a toxin, a radioisotope, a protein, a peptide, and a nucleic acid.
- the effector molecular is a cancer therapeutic agent.
- the cancer therapeutic agent is a chemotherapeutic.
- the cancer therapeutic agent is a highly radioactive atom selected, for example, from the group consisting of 211 At, 131 I, 125 I, 90 Y, 186 Re, 188 Re, 153 Sm, 212 Bi, 32 P, and 212 Pb.
- the effector molecule is a label that can generate a detectable signal, either directly or indirectly.
- the label is a radioisotope selected, for example, from the group consisting of 3 H, 14 C, 32 P,
- the anti-E7MC antibody moiety is an scFv. In some embodiments, the anti-E7MC antibody moiety is human, humanized, or semi- synthetic. In some embodiments, the anti-E7MC antibody moiety cross-reacts with at least one (such as at least any of 2, 3, 4, 5, or 6) complex comprising the MHC class I protein and a variant of the HPV16-E7 peptide having one amino acid substitution (such as a conservative amino acid substitution). In some embodiments, the anti-E7MC antibody moiety cross-reacts with at least one (such as at least any of 2, 3, 4, or 5) complex comprising the HPV16-E7 peptide and a different subtype of the MHC class I protein.
- an anti-E7MC immunoconjugate comprising a) an anti-E7MC antibody moiety that specifically binds to a complex comprising an HPV16-E7 11-19 peptide (SEQ ID NO: 4) and HLA-A*02:01, and b) an effector molecule.
- the effector molecule is covalently attached to the anti- E7MC antibody moiety.
- the effector molecule is a therapeutic agent selected, for example, from the group consisting of a drug, a toxin, a radioisotope, a protein, a peptide, and a nucleic acid.
- the effector molecular is a cancer therapeutic agent.
- the cancer therapeutic agent is a chemotherapeutic.
- the cancer therapeutic agent is a highly radioactive atom selected, for example, from the group consisting of 211 At, 131 I, 125 I, 90 Y, 186 Re, 188 Re, 153 Sm, 212 Bi, 32 P, and
- the effector molecule is a label that can generate a detectable signal, either directly or indirectly.
- the label is a radioisotope selected, for example, from the group consisting of 3 H, 14 C, 32 P, 35 S, 123 I, 125 I, and 131 I.
- the anti-E7MC antibody moiety is an scFv. In some embodiments, the anti-
- E7MC antibody moiety is human, humanized, or semi- synthetic.
- an anti-E7MC immunoconjugate comprising a) an anti-E7MC antibody moiety that specifically binds to a complex comprising an HPV16-E7 peptide and an MHC class I protein comprising i) a heavy chain variable domain sequence comprising an HC-CDR1 comprising the amino acid sequence of SEQ ID NO: 183, or a variant thereof comprising up to about 3 (for example about any of 1, 2, or 3) amino acid substitutions, an HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 184 or 185, or a variant thereof comprising up to about 3 (for example about any of 1, 2, or 3) amino acid substitutions, and an HC-CDR3 comprising the amino acid sequence of any one of SEQ ID NOs: 186-188, or a variant thereof comprising up to about 3 (for example about any of 1, 2, or 3) amino acid substitutions; and ii) a light chain variable domain comprising an LC-CDR1
- an LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 191, or a variant thereof comprising up to about 3 (for example about any of 1, 2, or 3) amino acid substitutions, and b) an effector molecule.
- an anti-E7MC immunoconjugate comprising a) an anti-E7MC antibody moiety that specifically binds to a complex comprising an HPV16-E7 peptide and an MHC class I protein comprising i) a heavy chain variable domain sequence comprising an HC-CDR1 comprising the amino acid sequence of SEQ ID NO: 183, an HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 184 or 185, and an HC-CDR3 comprising the amino acid sequence of any one of SEQ ID NOs: 186-188; and ii) a light chain variable domain comprising an LC-CDR1 comprising the amino acid sequence of SEQ ID NO: 189 or 190, and an LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 191, and b) an effector molecule.
- an anti-E7MC immunoconjugate comprising a) an anti-E7MC antibody moiety that specifically binds to a complex comprising an HPV16-E7 peptide and an MHC class I protein comprising i) a heavy chain variable domain comprising an HC-CDR1 comprising the amino acid sequence of any one of SEQ ID NO:
- NOs: 57-77 or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or
- an HC-CDR2 comprising the amino acid sequence of any one of
- SEQ ID NOs: 78-98 or a variant thereof comprising up to about 5 (such as about any of 1, 2,
- HC-CDR3 comprising the amino acid sequence of any one of SEQ ID NOs: 99-119, 244, and 245, or a variant thereof comprising up to about 5
- an LC-CDR2 comprising the amino acid sequence of any one of SEQ ID NOs: 141-161, or a variant thereof comprising up to about 3 (such as about any of 1, 2, or 3) amino acid substitutions
- an LC-CDR3 comprising the amino acid sequence of any one of SEQ ID NOs: 162-182 and 247-250, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions, and b) an effector molecule.
- an anti-E7MC immunoconjugate comprising a) an anti-E7MC antibody moiety that specifically binds to a complex comprising an HPV16-E7 peptide and an MHC class I protein comprising i) a heavy chain variable domain sequence comprising an HC-CDR1 comprising the amino acid sequence of any one of SEQ ID NOs: 57-77; an HC-CDR2 comprising the amino acid sequence of any one of SEQ ID NOs: 78-98; and an HC-CDR3 comprising the amino acid sequence of any one of SEQ ID NOs: 99-119, 244, and 245; or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions in the HC-CDR sequences; and ii) a light chain variable domain sequence comprising an LC-CDR1 comprising the amino acid sequence of any one of SEQ ID NOs: 120-140 and 246; an LC-C
- an anti-E7MC immunoconjugate comprising a) an anti-E7MC antibody moiety that specifically binds to a complex comprising an HPV16-E7 peptide and an MHC class I protein comprising i) a heavy chain variable domain sequence comprising an HC-CDR 1 comprising the amino acid sequence of any one of SEQ ID NOs: 57-77; an HC-CDR2 comprising the amino acid sequence of any one of SEQ ID NOs: 78-98; and an HC-CDR3 comprising the amino acid sequence of any one of SEQ ID NOs: 99-119, 244, and 245; and ii) a light chain variable domain sequence comprising an LC-CDR 1 comprising the amino acid sequence of any one of SEQ ID NOs: 120-140 and 246; an LC-CDR2 comprising the amino acid sequence of any one of SEQ ID NOs: 141-161; and an LC-CDR3 comprising the amino acid sequence of
- an anti-E7MC immunoconjugate comprising a) an anti-E7MC antibody moiety that specifically binds to a complex comprising an HPV16-E7 peptide and an MHC class I protein comprising a heavy chain variable domain comprising the amino acid sequence of any one of SEQ ID NOs: 15-35 and 233-237, or a variant thereof having at least about 95% (for example at least about any of 96%, 97%, 98%, or 99%) sequence identity, and a light chain variable domain comprising the amino acid sequence of any one of SEQ ID NOs: 36-56 and 238-243, or a variant thereof having at least about 95% (for example at least about any of 96%, 97%, 98%, or 99%) sequence identity, and b) an effector molecule.
- an anti-E7MC immunoconjugate comprising a) an anti-E7MC antibody moiety that specifically binds to a complex comprising an HPV16-E7 peptide and an MHC class I protein comprising a heavy chain variable domain comprising the amino acid sequence of any one of SEQ ID NOs: 15-35 and 233-237 and a light chain variable domain comprising the amino acid sequence of any one of SEQ ID NOs: 36-56 and 238-243, b) an effector molecule.
- Nucleic acid molecules encoding the anti-E7MC constructs or anti-E7MC antibody moieties are also contemplated.
- a nucleic acid (or a set of nucleic acids) encoding a multi- specific anti-E7MC molecule e.g. , a multi- specific anti-E7MC antibody, a bispecific anti-E7MC antibody, or a bispecific T-cell engager anti-E7MC antibody
- polypeptide portion thereof e.g. , a multi- specific anti-E7MC antibody, a bispecific anti-E7MC antibody, or a bispecific T-cell engager anti-E7MC antibody
- nucleic acid or a set of nucleic acids encoding an anti- E7MC CAR. In some embodiments, there is provided a nucleic acid (or a set of nucleic acids) encoding an anti-E7MC immunoconjugate, or polypeptide portion thereof.
- the present application also includes variants to these nucleic acid sequences.
- the variants include nucleotide sequences that hybridize to the nucleic acid sequences encoding the anti-E7MC constructs or anti-E7MC antibody moieties of the present application under at least moderately stringent hybridization conditions.
- the present invention also provides vectors in which a nucleic acid of the present invention is inserted.
- an anti-E7MC construct e.g. , anti-E7MC CAR
- polypeptide portion thereof by a natural or synthetic nucleic acid encoding the anti-E7MC construct or polypeptide portion thereof
- an appropriate expression vector such that the nucleic acid is operably linked to 5' and 3' regulatory elements, including for example a promoter (e.g., a lymphocyte- specific promoter) and a 3' untranslated region (UTR).
- the vectors can be suitable for replication and integration in eukaryotic host cells.
- Typical cloning and expression vectors contain transcription and translation terminators, initiation sequences, and promoters useful for regulation of the expression of the desired nucleic acid sequence.
- nucleic acids of the present invention may also be used for nucleic acid immunization and gene therapy, using standard gene delivery protocols. Methods for gene delivery are known in the art. See, e.g., U.S. Pat. Nos. 5,399,346, 5,580,859, 5,589,466, incorporated by reference herein in their entireties.
- the invention provides a gene therapy vector.
- the nucleic acid can be cloned into a number of types of vectors.
- the nucleic acid can be cloned into a vector including, but not limited to a plasmid, a phagemid, a phage derivative, an animal virus, and a cosmid.
- Vectors of particular interest include expression vectors, replication vectors, probe generation vectors, and sequencing vectors.
- the expression vector may be provided to a cell in the form of a viral vector.
- Viral vector technology is well known in the art and is described, for example, in Sambrook et al. (2001, Molecular Cloning: A Laboratory Manual, Cold Spring Harbor Laboratory, New York), and in other virology and molecular biology manuals.
- Viruses which are useful as vectors include, but are not limited to, retroviruses, adenoviruses, adeno- associated viruses, herpes viruses, and lentiviruses.
- a suitable vector contains an origin of replication functional in at least one organism, a promoter sequence, convenient restriction endonuclease sites, and one or more selectable markers (see, e.g. , WO 01/96584; WO 01/29058; and U.S. Pat. No. 6,326,193).
- retroviruses provide a convenient platform for gene delivery systems.
- a selected gene can be inserted into a vector and packaged in retroviral particles using techniques known in the art.
- the recombinant virus can then be isolated and delivered to cells of the subject either in vivo or ex vivo.
- retroviral systems are known in the art.
- adenovirus vectors are used.
- a number of adenovirus vectors are known in the art.
- lentivirus vectors are used. Vectors derived from retroviruses such as the lentivirus are suitable tools to achieve long-term gene transfer since they allow long-term, stable integration of a transgene and its propagation in daughter cells.
- Lentiviral vectors have the added advantage over vectors derived from onco-retroviruses such as murine leukemia viruses in that they can transduce non-proliferating cells, such as hepatocytes. They also have the added advantage of low immunogenicity.
- Additional promoter elements e.g. , enhancers, regulate the frequency of transcriptional initiation.
- these are located in the region 30-110 bp upstream of the start site, although a number of promoters have recently been shown to contain functional elements downstream of the start site as well.
- the spacing between promoter elements frequently is flexible, so that promoter function is preserved when elements are inverted or moved relative to one another.
- tk thymidine kinase
- a suitable promoter is the immediate early cytomegalovirus (CMV) promoter sequence.
- CMV immediate early cytomegalovirus
- This promoter sequence is a strong constitutive promoter sequence capable of driving high levels of expression of any polynucleotide sequence operatively linked thereto.
- Another example of a suitable promoter is Elongation Growth Factor- la (EF- la).
- EF- la Elongation Growth Factor- la
- other constitutive promoter sequences may also be used, including, but not limited to the simian virus 40 (SV40) early promoter, mouse mammary tumor virus
- MMTV human immunodeficiency virus
- LTR long terminal repeat
- MoMuLV avian leukemia virus promoter
- ELR Epstein-Barr virus immediate early promoter
- Rous sarcoma virus promoter as well as human gene promoters such as, but not limited to, the actin promoter, the myosin promoter, the hemoglobin promoter, and the creatine kinase promoter.
- the invention should not be limited to the use of constitutive promoters. Inducible promoters are also contemplated as part of the invention.
- an inducible promoter provides a molecular switch capable of turning on expression of the polynucleotide sequence which it is operatively linked when such expression is desired, or turning off the expression when expression is not desired.
- inducible promoters include, but are not limited to a metallothionine promoter, a glucocorticoid promoter, a progesterone promoter, and a tetracycline promoter.
- the expression vector to be introduced into a cell can also contain either a selectable marker gene or a reporter gene or both to facilitate identification and selection of expressing cells from the population of cells sought to be transfected or infected through viral vectors.
- the selectable marker may be carried on a separate piece of DNA and used in a co- transfection procedure. Both selectable markers and reporter genes may be flanked with appropriate regulatory sequences to enable expression in the host cells.
- Useful selectable markers include, for example, antibiotic -resistance genes, such as neo and the like.
- Reporter genes are used for identifying potentially transfected cells and for evaluating the functionality of regulatory sequences.
- a reporter gene is a gene that is not present in or expressed by the recipient organism or tissue and that encodes a polypeptide whose expression is manifested by some easily detectable property, e.g., enzymatic activity. Expression of the reporter gene is assayed at a suitable time after the DNA has been introduced into the recipient cells.
- Suitable reporter genes may include genes encoding luciferase, ⁇ -galactosidase, chloramphenicol acetyl transferase, secreted alkaline phosphatase, or the green fluorescent protein gene (e.g., Ui-Tel et ah, 2000 FEBS Letters 479: 79-82).
- Suitable expression systems are well known and may be prepared using known techniques or obtained commercially.
- the construct with the minimal 5' flanking region showing the highest level of expression of reporter gene is identified as the promoter.
- Such promoter regions may be linked to a reporter gene and used to evaluate agents for the ability to modulate promoter-driven transcription.
- the vector can be readily introduced into a host cell, e.g., mammalian, bacterial, yeast, or insect cell by any method in the art.
- the expression vector can be transferred into a host cell by physical, chemical, or biological means.
- Physical methods for introducing a polynucleotide into a host cell include calcium phosphate precipitation, lipofection, particle bombardment, microinjection, electroporation, and the like. Methods for producing cells comprising vectors and/or exogenous nucleic acids are well-known in the art. See, for example, Sambrook et al. (2001, Molecular Cloning: A Laboratory Manual, Cold Spring Harbor Laboratory, New York). In some embodiments, the introduction of a polynucleotide into a host cell is carried out by calcium phosphate transfection.
- Biological methods for introducing a polynucleotide of interest into a host cell include the use of DNA and RNA vectors.
- Viral vectors, and especially retroviral vectors have become the most widely used method for inserting genes into mammalian, e.g., human cells.
- Other viral vectors can be derived from lentivirus, poxviruses, herpes simplex virus 1, adenoviruses and adeno-associated viruses, and the like. See, for example, U.S. Pat. Nos. 5,350,674 and 5,585,362.
- Chemical means for introducing a polynucleotide into a host cell include colloidal dispersion systems, such as macromolecule complexes, nanocapsules, microspheres, beads, and lipid-based systems including oil-in-water emulsions, micelles, mixed micelles, and liposomes.
- colloidal dispersion systems such as macromolecule complexes, nanocapsules, microspheres, beads, and lipid-based systems including oil-in-water emulsions, micelles, mixed micelles, and liposomes.
- An exemplary colloidal system for use as a delivery vehicle in vitro and in vivo is a liposome (e.g., an artificial membrane vesicle).
- an exemplary delivery vehicle is a liposome.
- lipid formulations is contemplated for the introduction of the nucleic acids into a host cell (in vitro, ex vivo or in vivo).
- the nucleic acid may be associated with a lipid.
- the nucleic acid associated with a lipid may be encapsulated in the aqueous interior of a liposome, interspersed within the lipid bilayer of a liposome, attached to a liposome via a linking molecule that is associated with both the liposome and the oligonucleotide, entrapped in a liposome, complexed with a liposome, dispersed in a solution containing a lipid, mixed with a lipid, combined with a lipid, contained as a suspension in a lipid, contained or complexed with a micelle, or otherwise associated with a lipid.
- Lipid, lipid/DNA or lipid/expression vector associated compositions are not limited to any particular structure in solution.
- Lipids are fatty substances which may be naturally occurring or synthetic lipids.
- lipids include the fatty droplets that naturally occur in the cytoplasm as well as the class of compounds which contain long-chain aliphatic hydrocarbons and their derivatives, such as fatty acids, alcohols, amines, amino alcohols, and aldehydes.
- assays include, for example, "molecular biological” assays well known to those of skill in the art, such as Southern and Northern blotting, RT-PCR and PCR;
- biochemical assays such as detecting the presence or absence of a particular peptide, e.g., by immunological means (ELISAs and Western blots) or by assays described herein to identify agents falling within the scope of the invention.
- ELISAs and Western blots immunological means
- assays described herein to identify agents falling within the scope of the invention.
- MHC class I proteins are one of two primary classes of major histocompatibility complex (MHC) molecules (the other being MHC class II) and are found on nearly every nucleated cell of the body. Their function is to display fragments of proteins from within the cell to T cells; healthy cells will be ignored, while cells containing foreign proteins will be attacked by the immune system. Because MHC class I proteins present peptides derived from cytosolic proteins, the pathway of MHC class I presentation is often called the cytosolic or endogenous pathway. Class I MHC molecules bind peptides generated mainly from degradation of cytosolic proteins by the proteasome. The MHC Lpeptide complex is then inserted into the plasma membrane of the cell.
- MHC major histocompatibility complex
- class I MHC cytotoxic T cells
- CTLs cytotoxic T cells
- class I MHC can also present peptides generated from exogenous proteins, in a process known as cross-presentation.
- MHC class I proteins consist of two polypeptide chains, a and p2-microglobulin ( ⁇ 2 ⁇ ). The two chains are linked noncovalently via interaction of b2m and the a3 domain. Only the a chain is polymorphic and encoded by a HLA gene, while the b2m subunit is not polymorphic and encoded by the ⁇ -2 microglobulin gene. The a3 domain is plasma membrane- spanning and interacts with the CD8 co-receptor of T-cells.
- the a3-CD8 interaction holds the MHC I molecule in place while the T cell receptor (TCR) on the surface of the cytotoxic T cell binds its al-a2 heterodimer ligand, and checks the coupled peptide for antigenicity.
- TCR T cell receptor
- the al and a2 domains fold to make up a groove for peptides to bind.
- MHC class I proteins bind peptides that are 8-10 amino acid in length.
- the human leukocyte antigen (HLA) genes are the human versions of the MHC genes.
- the three major MHC class I proteins in humans are HLA-A, HLA-B, and HLA-C, while the 3 minor ones are HLA-E, HLA-F, and HLA-G.
- HLA-A is ranked among the genes in humans with the fastest-evolving coding sequence. As of December 2013, there were 2432 known HLA-A alleles coding for 1740 active proteins and 117 null proteins.
- the HLA-A gene is located on the short arm of chromosome 6 and encodes the larger, a-chain, constituent of HLA-A. Variation of HLA-A a-chain is key to HLA function. This variation promotes genetic diversity in the population.
- HLA-A Since each HLA has a different affinity for peptides of certain structures, greater variety of HLAs means greater variety of antigens to be 'presented' on the cell surface, enhancing the likelihood that a subset of the population will be resistant to any given foreign invader. This decreases the likelihood that a single pathogen has the capability to wipe out the entire human population.
- Each individual can express up to two types of HLA-A, one from each of their parents. Some individuals will inherit the same HLA-A from both parents, decreasing their individual HLA diversity; however, the majority of individuals will receive two different copies of HLA-A. This same pattern follows for all HLA groups. In other words, a person can only express either one or two of the 2432 known HLA-A alleles.
- All alleles receive at least a four digit classification, e.g. , HLA-A*02: 12.
- the A signifies which HLA gene the allele belongs to.
- the next pair of digits indicates this assignment.
- HLA-A*02:02, HLA-A*02:04, and HLA-A*02:324 are all members of the A2 serotype (designated by the *02 prefix). This group is the primary factor responsible for HLA compatibility. All numbers after this cannot be determined by serotyping and are designated through gene sequencing.
- the second set of digits indicates what HLA protein is produced. These are assigned in order of discovery and as of December
- HLA-A*02:456 The shortest possible HLA name includes both of these details. Each extension beyond that signifies a nucleotide change that may or may not change the protein.
- the anti-E7MC antibody moiety specifically binds to a complex comprising an HPV16-E7 peptide and an MHC class I protein, wherein the MHC class I protein is HLA-A, HLA-B, HLA-C, HLA-E, HLA-F, or HLA-G.
- MHC class I protein is HLA-A, HLA-B, HLA-C, HLA-E, HLA-F, or HLA-G.
- the MHC class I protein is HLA-A, HLA-B, or HLA-C. In some embodiments, the MHC class I protein is HLA-A. In some embodiments, the MHC class I protein is HLA-C
- the MHC class I protein is HLA-C. In some embodiments, the
- MHC class I protein is HLA-A01, HLA-A02, HLA-A03, HLA-A09, HLA-A 10, HLA-A11,
- HLA-A 19 HLA-A23, HLA-A24, HLA-A25, HLA-A26, HLA-A28, HLA-A29, HLA-A30,
- the MHC class I protein is HLA-A69, HLA-A74, or HLA-A80.
- the MHC class I protein is HLA-
- the MHC class I protein is any one of HLA-A*02:01-555, such as HLA-A*02:01, HLA-A*02:02, HLA-A*02:03, HLA-A*02:04, HLA-A*02:05, HLA-A*02:01-555, such as HLA-A*02:01, HLA-A*02:02, HLA-A*02:03, HLA-A*02:04, HLA-A*02:05, HLA-
- the MHC class I protein is HLA-A*02:01.
- HLA- A*02:01 is expressed in 39-46% of all Caucasians, and therefore represents a suitable choice of MHC class I protein for use in the present invention.
- HPV16-E7 peptides suitable for use in generating anti-E7MC antibody moieties can be determined, for example, based on the presence of HLA-A*02:01 -binding motifs and cleavage sites for proteasomes and immune-proteasomes using computer prediction models known to those of skill in the art.
- models include, but are not limited to, IEDB (Vita et al., The immune epitope database (IEDB) 3.0. Nucleic Acids Res. 2014 Oct 9. pii: gku938), ProPredl (described in more detail in Singh and Raghava, ProPred: prediction ofHLA-DR binding sites.
- BIOINFORMATICS 17(12): 1236- 1237, 2001), and SYFPEITHI see Schuler et al. SYFPEITHI, Database for Searching and T-Cell Epitope Prediction, in Immunoinformatics Methods in Molecular Biology, vol 409(1): 75-93, 2007).
- peptide synthesis may be done in accordance with protocols well known to those of skill in the art. Because of their relatively small size, the peptides of the invention may be directly synthesized in solution or on a solid support in accordance with conventional peptide synthesis techniques. Various automatic synthesizers are commercially available and can be used in accordance with known protocols. The synthesis of peptides in solution phase has become a well-established procedure for large-scale production of synthetic peptides and as such is a suitable alternative method for preparing the peptides of the invention (See for example, Solid Phase Peptide Synthesis by John Morrow Stewart and Martin et al. Application of Almez-mediated Amidation Reactions to Solution Phase Peptide Synthesis, Tetrahedron Letters Vol. 39, pages 1517-1520, 1998).
- the binding activity of candidate HPV16-E7 peptides can be tested using the antigen -processing-deficient T2 cell line, which increases expression of HLA-A when stabilized by a peptide in the antigen-presenting groove.
- T2 cells are pulsed with the candidate peptide for a time sufficient to stabilize HLA-A expression on the cell surface, which can be measured using any methods known in the art, such as by immuno staining with a fluorescently labeled monoclonal antibody specific for HLA-A (for example, BB7.2) followed by fluorescence-activated cell-sorting (FACS) analysis.
- FACS fluorescence-activated cell-sorting
- the anti-E7MC antibody or anti-E7MC antibody moiety is a monoclonal antibody.
- Monoclonal antibodies can be prepared, e.g., using hybridoma methods, such as those described by Kohler and Milstein, Nature, 256:495 (1975) and Sergeeva et al, Blood, 117(16):4262-4272, using the phage display methods described herein and in the Examples below, or using recombinant DNA methods ⁇ see, e.g., US Patent No. 4,816,567).
- a hamster, mouse, or other appropriate host animal is typically immunized with an immunizing agent to elicit lymphocytes that produce or are capable of producing antibodies that will specifically bind to the immunizing agent.
- the lymphocytes can be immunized in vitro.
- the immunizing agent can include a polypeptide or a fusion protein of the protein of interest, or a complex comprising at least two molecules, such as a complex comprising an HPV16-E7 peptide and an MHC class I protein.
- PBLs peripheral blood lymphocytes
- the lymphocytes are then fused with an immortalized cell line using a suitable fusing agent, such as polyethylene glycol, to form a hybridoma cell.
- Immortalized cell lines are usually transformed mammalian cells, particularly myeloma cells of rodent, bovine, and human origin. Usually, rat or mouse myeloma cell lines are employed.
- the hybridoma cells can be cultured in a suitable culture medium that preferably contains one or more substances that inhibit the growth or survival of the unfused, immortalized cells.
- the culture medium for the hybridomas typically will include hypoxanthine, aminopterin, and thymidine ("HAT medium”), which prevents the growth of HGPRT-deficient cells.
- HGPRT hypoxanthine guanine phosphoribosyl transferase
- the immortalized cell lines fuse efficiently, support stable high-level expression of antibody by the selected antibody-producing cells, and are sensitive to a medium such as HAT medium.
- the immortalized cell lines are murine myeloma lines, which can be obtained, for instance, from the Salk Institute Cell Distribution Center, San Diego, California and the American Type Culture Collection, Manassas, Virginia. Human myeloma and mouse-human heteromyeloma cell lines also have been described for the production of human monoclonal antibodies. Kozbor, J. Immunol., 133:3001 (1984); Brodeur et al. Monoclonal Antibody Production Techniques and
- the culture medium in which the hybridoma cells are cultured can then be assayed for the presence of monoclonal antibodies directed against the polypeptide.
- the binding specificity of monoclonal antibodies produced by the hybridoma cells can be determined by immunoprecipitation or by an in vitro binding assay, such as radioimmunoassay (RIA) or enzyme-linked immunoabsorbent assay (ELISA). Such techniques and assays are known in the art.
- the binding affinity of the monoclonal antibody can, for example, be determined by the Scatchard analysis of Munson and Pollard, Anal. Biochem., 107:220 (1980).
- the clones can be sub cloned by limiting dilution procedures and grown by standard methods. Goding, supra. Suitable culture media for this purpose include, for example, Dulbecco's Modified Eagle's Medium and RPMI-1640 medium. Alternatively, the hybridoma cells can be grown in vivo as ascites in a mammal.
- the monoclonal antibodies secreted by the sub clones can be isolated or purified from the culture medium or ascites fluid by conventional immunoglobulin purification procedures such as, for example, protein A-Sepharose, hydroxylapatite chromatography, gel electrophoresis, dialysis, or affinity chromatography.
- the anti-E7MC antibodies or antibody moieties may also be identified by screening combinatorial libraries for antibodies with the desired activity or activities. For example, a variety of methods are known in the art for generating phage display libraries and screening such libraries for antibodies possessing the desired binding characteristics.
- phage display methods repertoires of VH and VL genes are separately cloned by polymerase chain reaction (PCR) and recombined randomly in phage libraries, which can then be screened for antigen -binding phage as described in Winter et al. , Ann. Rev. Immunol., 12: 433-455 (1994). Phage typically display antibody fragments, either as single- chain Fv (scFv) fragments or as Fab fragments. Libraries from immunized sources provide high-affinity antibodies to the immunogen without the requirement of constructing hybridomas.
- PCR polymerase chain reaction
- naive repertoire can be cloned ⁇ e.g., from human) to provide a single source of antibodies to a wide range of non-self and also self antigens without any immunization as described by Griffiths et al, EMBO J, 12: 725-734 (1993).
- naive libraries can also be made synthetically by cloning unrearranged V-gene segments from stem cells, and using PCR primers containing random sequence to encode the highly variable CDR3 regions and to accomplish rearrangement in vitro, as described by Hoogenboom and Winter, J. Mol. Biol, 227: 381-388 (1992).
- Patent publications describing human antibody phage libraries include, for example: U.S. Pat. No. 5,750,373, and US Patent Publication Nos. 2005/0079574, 2005/0119455, 2005/0266000, 2007/0117126, 2007/0160598, 2007/0237764, 2007/0292936, and 2009/0002360.
- the antibodies or antigen-binding fragments thereof can be prepared using phage display to screen libraries for antibodies specific to a complex comprising an HPV16-E7 peptide and an MHC class I protein.
- the library can be a human scFv phage display library having a diversity of at least one x 10 9 (such as at least about any of 1 x 10 9 , 2.5 x 10 9 , 5 x 10 9 , 7.5 x 10 9 , 1 x 10 10 , 2.5 x 10 10 , 5 x 10 10 , 7.5 x 10 10 , or 1 x 10 11 ) unique human antibody fragments.
- the library is a naive human library constructed from DNA extracted from human PMBCs and spleens from healthy donors, encompassing all human heavy and light chain subfamilies.
- the library is a naive human library constructed from DNA extracted from PBMCs isolated from patients with various diseases, such as patients with autoimmune diseases, cancer patients, and patients with infectious diseases.
- the library is a semi-synthetic human library, wherein heavy chain CDR3 is completely randomized, with all amino acids (with the exception of cysteine) equally likely to be present at any given position ⁇ see, e.g., Hoet, R.M. et al, Nat. Biotechnol. 23(3):344-348, 2005).
- the heavy chain CDR3 of the semi- synthetic human library has a length from about 5 to about 24 (such as about any of 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, or 24) amino acids.
- the library is a non-human phage display library.
- Phage clones that bind to the E7MC with high affinity can be selected by iterative binding of phage to the E7MC, which is bound to a solid support (such as, for example, beads for solution panning or mammalian cells for cell panning), followed by removal of non- bound phage and by elution of specifically bound phage.
- a solid support such as, for example, beads for solution panning or mammalian cells for cell panning
- the E7MC can be biotinylated for immobilization to a solid support.
- the biotinylated E7MC is mixed with the phage library and a solid support, such as strep tavidin-conjugated
- Dynabeads M-280, and then E7MC-phage-bead complexes are isolated.
- the bound phage clones are then eluted and used to infect an appropriate host cell, such as E. coli XLl-Blue, for expression and purification.
- an appropriate host cell such as E. coli XLl-Blue
- T2 cells a TAP-deficient, HLA-A*02:01 + lymphoblast cell line
- the HPV16-E7 peptide of the E7MC are mixed with the phage library, after which the cells are collected and the bound clones are eluted and used to infect an appropriate host cell for expression and purification.
- the panning can be performed for multiple (such as about any of 2, 3, 4, 5, 6 or more) rounds with either solution panning, cell panning, or a combination of both, to enrich for phage clones binding specifically to the E7MC.
- Enriched phage clones can be tested for specific binding to the E7MC by any methods known in the art, including for example ELISA and FACS.
- Monoclonal antibodies can also be made by recombinant DNA methods, such as those described in U.S. Patent No. 4,816,567.
- DNA encoding the monoclonal antibodies of the invention can be readily isolated and sequenced using conventional procedures (e.g., by using oligonucleotide probes that are capable of binding specifically to genes encoding the heavy and light chains of murine antibodies).
- Hybridoma cells as described above or E7MC- specific phage clones of the invention can serve as a source of such DNA.
- the DNA can be placed into expression vectors, which are then transfected into host cells such as simian COS cells, Chinese hamster ovary (CHO) cells, or myeloma cells that do not otherwise produce immunoglobulin protein, to obtain the synthesis of monoclonal antibodies in the recombinant host cells.
- host cells such as simian COS cells, Chinese hamster ovary (CHO) cells, or myeloma cells that do not otherwise produce immunoglobulin protein, to obtain the synthesis of monoclonal antibodies in the recombinant host cells.
- the DNA also can be modified, for example, by substituting the coding sequence for human heavy- and light-chain constant domains and/or framework regions in place of the homologous non-human sequences (U.S. Patent No. 4,816,567;
- non- immunoglobulin polypeptide can be substituted for the constant domains of an antibody of the invention, or can be substituted for the variable domains of one antigen-combining site of an antibody of the invention to create a chimeric bivalent antibody.
- the antibodies can be monovalent antibodies.
- Methods for preparing monovalent antibodies are known in the art. For example, one method involves recombinant expression of immunoglobulin light chain and modified heavy chain. The heavy chain is truncated generally at any point in the Fc region so as to prevent heavy-chain crosslinking.
- cysteine residues are substituted with another amino acid residue or are deleted so as to prevent crosslinking.
- In vitro methods are also suitable for preparing monovalent antibodies. Digestion of antibodies to produce fragments thereof, particularly Fab fragments, can be accomplished using any method known in the art.
- Antibody variable domains with the desired binding specificities can be fused to immunoglobulin constant-domain sequences.
- the fusion preferably is with an immunoglobulin heavy-chain constant domain, comprising at least part of the hinge, CH2, and CH3 regions.
- the first heavy-chain constant region (CHI) containing the site necessary for light-chain binding is present in at least one of the fusions.
- DNAs encoding the immunoglobulin heavy-chain fusions and, if desired, the immunoglobulin light chain are inserted into separate expression vectors, and are co- transfected into a suitable host organism.
- the anti-E7MC antibodies or antibody moieties can be humanized antibodies or human antibodies.
- Humanized forms of non-human (e.g., murine) antibodies are chimeric immunoglobulins, immunoglobulin chains, or fragments thereof (such as Fv, Fab, Fab', F(ab') 2 , scFv, or other antigen-binding subsequences of antibodies) that typically contain minimal sequence derived from non-human immunoglobulin.
- Humanized antibodies include human immunoglobulins (recipient antibody) in which residues from a CDR of the recipient are replaced by residues from a CDR of a non-human species (donor antibody) such as mouse, rat, or rabbit having the desired specificity, affinity, and capacity.
- Fv framework residues of the human immunoglobulin are replaced by corresponding non- human residues.
- Humanized antibodies can also comprise residues that are found neither in the recipient antibody nor in the imported CDR or framework sequences.
- the humanized antibody can comprise substantially all of at least one, and typically two, variable domains, in which all or substantially all of the CDR regions correspond to those of a non- human immunoglobulin, and all or substantially all of the FR regions are those of a human immunoglobulin consensus sequence.
- the humanized antibody will comprise at least a portion of an immunoglobulin constant region (Fc), typically that of a human immunoglobulin.
- Fc immunoglobulin constant region
- a humanized antibody has one or more amino acid residues introduced into it from a source that is non-human. These non-human amino acid residues are often referred to as "import" residues, which are typically taken from an "import" variable domain.
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Immunology (AREA)
- Medicinal Chemistry (AREA)
- General Health & Medical Sciences (AREA)
- Organic Chemistry (AREA)
- Veterinary Medicine (AREA)
- Public Health (AREA)
- Pharmacology & Pharmacy (AREA)
- Animal Behavior & Ethology (AREA)
- Epidemiology (AREA)
- Mycology (AREA)
- Microbiology (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Virology (AREA)
- Cell Biology (AREA)
- Genetics & Genomics (AREA)
- Engineering & Computer Science (AREA)
- Molecular Biology (AREA)
- Biophysics (AREA)
- Biochemistry (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Gastroenterology & Hepatology (AREA)
- General Chemical & Material Sciences (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Peptides Or Proteins (AREA)
- Micro-Organisms Or Cultivation Processes Thereof (AREA)
- Measuring Or Testing Involving Enzymes Or Micro-Organisms (AREA)
- Medicinal Preparation (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
- Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
- Medicines Containing Material From Animals Or Micro-Organisms (AREA)
Abstract
The present application provides constructs comprising an antibody moiety that specifically binds to a complex comprising an HPV16-E7 peptide and an MHC class I protein. Also provided are methods of making and using these constructs.
Description
CONSTRUCTS TARGETING HPV16-E7 PEPTIDE/MHC COMPLEXES AND USES
THEREOF
CROSS-REREFENCE TO RELATED APPLICATIONS
[0001] This application claims priority to U.S. Provisional Application No. 62/158,735, filed on May 8, 2015, and U.S. Provisional Application No. 62/197,480, filed on July 27, 2015, all of which are hereby incorporated by reference in their entireties.
FIELD OF THE INVENTION
[0002] This invention pertains to antibody constructs that specifically bind MHC molecules complexed with HPV16-E7 peptides, and uses thereof including treating and diagnosing diseases.
SUBMISSION OF SEQUENCE LISTING ON ASCII TEXT FILE
[0003] The content of the following submission on ASCII text file is incorporated herein by reference in its entirety: a computer readable form (CRF) of the Sequence Listing (file name: 750042000240SEQLIST.txt, date recorded: May 6, 2016, size: 125 KB).
BACKGROUND OF THE INVENTION
[0004] Human papillomaviruses (HPVs) are small, non-enveloped DNA viruses that cause warts or benign papillomas upon infection in epithelial cells. Persistent infections with high- risk HPV types can lead to more serious cytological abnormalities or lesions that, if untreated, may progress to cancer. Annual incidence of HPV-associated cancers is >26,000 in the US (according to CDC) and >600,000 worldwide (Forman D. et al., Vaccine, 30: Suppl 5:F12-23, 2012). Different types of HPV are responsible for causing almost all cases of cervical cancer (Doorbar J., Clin. Sci., 110:525-541, 2006), the third leading cause of cancer- related deaths in women worldwide. In addition to cervical cancers, HPV is also associated with anogenital cancers (anus, penis, vagina and vulva) and head/neck cancers (oropharynx: back of the throat, including the base of the tongue and tonsils). In a meta-analysis of 5,046 head and neck squamous cell carcinomas (HNSCC) cancer specimens from 60 studies, the overall HPV prevalence was found to be 25.9%. Among HPV-positive HNSCC, HPV-16 was found in 86.7% of the HPV-positive oropharyngeal SCCs, 68.2% of oral SCCs and 69.2% of
laryngeal SCCs. (Kreimer A.R. et al., Cancer Epidemiol Biomarkers Prev. 14:467-475, 2005). In a more recent study (The Cancer Genome Atlas Network, Nature, 517:576-582, 2015) that classified HPV status by presence of >1,000 mapped RNA sequencing (RNA-Seq) reads of HPV E6 and E7 proteins, 36 out of 279 (12.9%) were found to be HPV-positive.
[0005] Cancer development upon persistent infection with high risk HPV subtype is mainly attributable to the expression of two potential oncogenes, E6 and E7, which have been documented to degrade p53 and Rb in a proteasome-dependent manner, thereby promoting genomic instability and cellular transformation (Doorbar, supra). The HPV E6 and E7 oncoproteins are continuously expressed in the lesions, while tumor arises only several years after the initial cellular immortalizing events. In fact, the continuous expression of E6 and E7 is required for maintenance of the transformed phenotype, and prevention of cell growth arrest and/or apoptosis (McLaughlin-Drubin M.E. & Miinger K., Virology, 384:335-344, 2009). Since established lesions do not express LI, there is an unmet need for treatment of HPV+ cancers despite the availability of approved prophylactic vaccines directed against the LI protein of HPV-6, 11, 16 and 18 subtypes.
[0006] Proteins expressed by oncogenic viruses such as HPV represent excellent targets for immunotherapy due to absence of expression in normal cells. E6 and E7 are intracellular proteins that have not been targeted by traditional drug development efforts using low molecular weight compounds or antibody approaches against cell surface proteins. Recent studies in HPV16-positive high-grade vulvar intraepithelial neoplasia have demonstrated T cell and clinical responses in 50% of patients treated with vaccination approaches that utilized E6/E7 peptides (Kenter G.G. et al., N. Engl. J. Med. 361: 1838-1847, 2009; Welters M.J. et al, N. Engl. J. Med. 361: 1838-1847, 2010; Daayana S. et al, Br. J. Cancer
102: 1129-1136, 2010). Among 13 distinct predicted HLA-A*02:01 -binding E7 peptides, only E7ii_i9 (YMLDLQPET), was found to be naturally processed and displayed on HPV- 16 transformed HLA-A*02:01 expressing cell lines in vitro (Riemer A.B. et al., J. Biol. Chem. 285(38):29608-29622, 2010). This peptide is conserved in 16 out of 17 HPV-16 variants in the HPV database (Zhang G.L. et al, Database, 1-12, 2014).
[0007] Recent advances in using phage display to generate mAbs have made it possible to select agents with exquisite specificity against defined epitopes from large antibody repertoires. A number of such mAbs specific for solid tumor antigens, in the context of HLA- A01 and HLA-A02, have been successfully selected from phage display libraries (Noy et al.,
Expert Rev. Anticancer Ther. 5(3):523-536, 2005; Chames et al, Proc. Natl. Acad. Sci. USA 97:7969-7974, 2000; Held et al, Eur. J. Immunol. 34:2919-2929, 2004; Lev et al, Cancer Res. 62:3184-3194, 2002; Klechevsky et al, Cancer Res. 68(15):6360-6367, 2008). More recently, a human mAb specific for human WT1/HLA-A02 complex, a well-described T cell epitope, has been shown to inhibit multiple cancer cell lines and primary cancer cells via Fc- mediated effector cell function (Dao et al, Sci. Transl. Med. 5: 176ra33, 2013; Veomett et al, Clin. Cancer Res. doi: 10.1158/1078-0432, 2014) in cellular assays and in in vivo models.
[0008] The disclosures of all publications, patents, patent applications and published patent applications referred to herein are hereby incorporated herein by reference in their entirety.
BRIEF SUMMARY OF THE INVENTION
[0009] The present application in one aspect provides constructs (such as isolated constructs) that bind to a complex comprising an HPV16-E7 peptide and an MHC class I protein
(referred to herein as an "HPV16-E7/MHC class I complex," or "E7MC"). In some embodiments, the constructs ("anti-E7MC constructs") comprise an antibody moiety
(referred to herein as an "anti-E7MC antibody moiety") that specifically binds to a complex comprising an HPV16-E7 peptide and an MHC class I protein.
[0010] Thus, in some embodiments, there is provided an anti-E7MC construct (such as an isolated anti-E7MC construct) comprising an antibody moiety that specifically binds to a complex comprising an HPV16-E7 peptide and an MHC class I protein. In some
embodiments, the HPV16-E7/MHC class I complex is present on a cell surface. In some embodiments, the HPV16-E7/MHC class I complex is present on the surface of a cancer cell.
[0011] In some embodiments, the anti-E7MC construct comprises an antibody moiety that specifically binds to a complex comprising an HPV16-E7 peptide and an MHC class I protein, wherein the MHC class I protein is HLA-A. In some embodiments, the MHC class I protein is HLA-A02. In some embodiments, the MHC class I protein is the HLA-A*02:01 subtype of the HLA-A02 allele.
[0012] In some embodiments, according to any of the anti-E7MC constructs (such as isolated anti-E7MC constructs) described above, the anti-E7MC construct comprises an antibody moiety that specifically binds to a complex comprising an HPV16-E7 peptide and an MHC class I protein, wherein the antibody moiety cross-reacts with a complex comprising the HPV16-E7 peptide and a second MHC class I protein having a different HLA allele than the
MHC class I protein. In some embodiments, the antibody moiety cross-reacts with a complex comprising a variant of the HPV16-E7 peptide comprising one amino acid substitution (such as a conservative amino acid substitution) and the MHC class I protein.
[0013] In some embodiments, according to any of the anti-E7MC constructs (such as isolated anti-E7MC construct) described above, the anti-E7MC construct comprises an antibody moiety that specifically binds to a complex comprising an HPV16-E7 peptide and an MHC class I protein, wherein the HPV16-E7 peptide is about 8 to about 12 (such as about any of 8, 9, 10, 11, or 12) amino acids in length. In some embodiments, the HPV16-E7 peptide has an amino acid sequence selected from the group consisting of SEQ ID NOs: 3-14. In some embodiments, the HPV16-E7 peptide has the amino acid sequence YMLDLQPET (SEQ ID NO: 4).
[0014] In some embodiments, according to any of the anti-E7MC constructs (such as isolated anti-E7MC constructs) described above, the anti-E7MC construct comprises an antibody moiety that specifically binds to a complex comprising an HPV16-E7 peptide and an MHC class I protein, wherein the antibody moiety is a full-length antibody, a Fab, a Fab', a (Fab')2, an Fv, or a single chain Fv (scFv). In some embodiments, the antibody moiety is fully human, semi- synthetic with human antibody framework regions, or humanized.
[0015] In some embodiments, according to any of the anti-E7MC constructs (such as isolated anti-E7MC constructs) described above, the anti-E7MC construct comprises an antibody moiety that specifically binds to a complex comprising an HPV16-E7 peptide and an MHC class I protein, wherein the antibody moiety binds to the HPV16-E7/MHC class I complex with an equilibrium dissociation constant (¾) between about 0.1 pM to about 500 nM (such as about any of 0.1 pM, 1.0 pM, 10 pM, 50 pM, 100 pM, 500 pM, 1 nM, 10 nM, 50 nM, 100 nM, or 500 nM, including any ranges between these values). In some embodiments, the isolated anti-E7MC construct binds to the HPV16-E7/MHC class I complex with a Kd between about 0.1 pM to about 500 nM (such as about any of 0.1 pM, 1.0 pM, 10 pM, 50 pM, 100 pM, 500 pM, 1 nM, 10 nM, 50 nM, 100 nM, or 500 nM, including any ranges between these values).
[0016] In some embodiments, the anti-E7MC construct comprises an antibody moiety that specifically binds to a complex comprising an HPV16-E7 peptide and an MHC class I protein, wherein the antibody moiety comprises: i) a heavy chain variable domain comprising a heavy chain complementarity determining region (HC-CDR) 1 comprising the amino acid sequence of G-F/G/Y-S/T-F-S/T-S-Y-A/G (SEQ ID NO: 183), or a variant thereof
comprising up to about 3 (such as about any of 1, 2, or 3) amino acid substitutions, an HC- CDR2 comprising the amino acid sequence of I-N/I-P-X-X-G-G/T/I-T/A/P or I-S-X-S/D- G/N-G/S-N-T/I/K (SEQ ID NO: 184 or 185), or a variant thereof comprising up to about 3 (such as about any of 1, 2, or 3) amino acid substitutions, and an HC-CDR3 comprising the amino acid sequence of any one of A-R-S/R-Y/S/G-Y/V-Y/W-G-X-Y-D, A-R-G-X-X-X-Y- Y/G/S, or A-R-G-X-X-Y-Q/W-W-S-X-D-D (SEQ ID NOs: 186-188), or a variant thereof comprising up to about 3 (such as about any of 1, 2, or 3) amino acid substitutions; and ii) a light chain variable domain comprising a light chain complementarity determining region (LC-CDR) 1 comprising the amino acid sequence of N-I-G-S-N/K or L-R-S/N-X-Y (SEQ ID NO: 189 or 190), or a variant thereof comprising up to about 3 (such as about any of 1, 2, or 3) amino acid substitutions, and an LC-CDR3 comprising the amino acid sequence of A/Q/N- S/A/V-W/Y/R-D-S/D-S-L/S/G-X-X-X-V (SEQ ID NO: 191), or a variant thereof comprising up to about 3 (such as about any of 1, 2, or 3) amino acid substitutions, wherein X can be any amino acid.
[0017] In some embodiments, the anti-E7MC construct comprises an antibody moiety that specifically binds to a complex comprising an HPV16-E7 peptide and an MHC class I protein, wherein the antibody moiety comprises: i) a heavy chain variable domain comprising an HC-CDR1 comprising (and in some embodiments consisting of) the amino acid sequence of any one of SEQ ID NOs: 57-77, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions, an HC-CDR2 comprising (and in some embodiments consisting of) the amino acid sequence of any one of SEQ ID NOs: 78-98, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions, and an HC-CDR3 comprising (and in some embodiments consisting of) the amino acid sequence of any one of SEQ ID NOs: 99-119, 244, and 245, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions; and ii) a light chain variable domain comprising an LC-CDR 1 comprising (and in some embodiments consisting of) the amino acid sequence of any one of SEQ ID NOs: 120-140 and 246, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions, an LC-CDR2 comprising (and in some embodiments consisting of) the amino acid sequence of any one of SEQ ID NOs: 141-161, or a variant thereof comprising up to about 3 (such as about any of 1, 2, or 3) amino acid substitutions, and an LC-CDR3 comprising (and in some embodiments consisting of) the amino acid sequence of
any one of SEQ ID NOs: 162-182 and 247-250, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions.
[0018] In some embodiments, the anti-E7MC construct comprises an antibody moiety that specifically binds to a complex comprising an HPV16-E7 peptide and an MHC class I protein, wherein the antibody moiety comprises: i) a heavy chain variable domain comprising an HC-CDR1 comprising (and in some embodiments consisting of) the amino acid sequence of any one of SEQ ID NOs: 57-77, an HC-CDR2 comprising (and in some embodiments consisting of) the amino acid sequence of any one of SEQ ID NOs: 78-98, and an HC-CDR3 comprising (and in some embodiments consisting of) the amino acid sequence of any one of SEQ ID NOs: 99-119, 244, and 245; or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions in the HC-CDR regions; and ii) a light chain variable domain comprising an LC-CDR1 comprising (and in some embodiments consisting of) the amino acid sequence of any one of SEQ ID NOs: 120-140 and 246, an LC- CDR2 comprising (and in some embodiments consisting of) the amino acid sequence of any one of SEQ ID NOs: 141-161, and an LC-CDR3 comprising (and in some embodiments consisting of) the amino acid sequence of any one of SEQ ID NOs: 162-182 and 247-250; or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions in the LC-CDR regions.
[0019] In some embodiments, the anti-E7MC construct comprises an antibody moiety that specifically binds to a complex comprising an HPV16-E7 peptide and an MHC class I protein, wherein the antibody moiety comprises a) a heavy chain variable domain comprising (and in some embodiments consisting of) the amino acid sequence of any one of SEQ ID NOs: 15-35 and 233-237 or a variant thereof having at least about 95% (such as at least about any of 95%, 96%, 97%, 98%, or 99%) sequence identify to any one of SEQ ID NOs: 15-35 and 233-237; and b) a light chain variable domain comprising (and in some embodiments consisting of) the amino acid sequence of any one of SEQ ID NOs: 36-56 and 238-243 or a variant thereof having at least about 95% (such as at least about any of 95%, 96%, 97%, 98%, or 99%) sequence identity to any one of SEQ ID NOs: 36-56 and 238-243. In some embodiments, the antibody moiety comprises a heavy chain variable domain comprising (and in some embodiments consisting of) the amino acid sequence of any one of SEQ ID NOs: 15- 35 and 233-237 and a light chain variable domain comprising (and in some embodiments consisting of) the amino acid sequence of any one of SEQ ID NOs: 36-56 and 238-243.
[0020] In some embodiments, the anti-E7MC construct comprises a first antibody moiety that competes for binding to a target HPV16-E7/MHC class I complex with a second antibody moiety according to any of the antibody moieties described above. In some embodiments, the first antibody moiety binds to the same, or substantially the same, epitope as the second antibody moiety. In some embodiments, binding of the first antibody moiety to the target HPV16-E7/MHC class I complex inhibits binding of the second antibody moiety to the target HPV16-E7/MHC class I complex by at least about 70% (such as by at least about any of 75%, 80%, 85%, 90%, 95%, 98% or 99%), or vice versa. In some embodiments, the first antibody moiety and the second antibody moiety cross-compete for binding to the target HPV16-E7/MHC class I complex, i.e., each of the first and second antibody moieties competes with the other for binding to the target HPV16-E7/MHC class I complex.
[0021] In some embodiments, according to any of the anti-E7MC constructs described above (such as isolated anti-E7MC constructs), the isolated anti-E7MC construct is a full-length antibody. In some embodiments, the isolated anti-E7MC construct is monospecific. In some embodiments, the isolated anti-E7MC construct is multi- specific. In some embodiments, the isolated anti-E7MC construct is bispecific. In some embodiments, the isolated anti-E7MC molecule is a tandem scFv, a diabody (Db), a single chain diabody (scDb), a dual-affinity retargeting (DART) antibody, a dual variable domain (DVD) antibody, a knob-into-hole (KiH) antibody, a dock and lock (DNL) antibody, a chemically cross-linked antibody, a heteromultimeric antibody, or a heteroconjugate antibody. In some embodiments, the isolated anti-E7MC construct is a tandem scFv comprising two scFvs linked by a peptide linker. In some embodiments, the peptide linker comprises (and in some embodiments consists of) the amino acid sequence GGGGS.
[0022] In some embodiments, according to any of the anti-E7MC constructs described above (such as isolated anti-E7MC constructs), the anti-E7MC construct comprises an antibody moiety that specifically binds to a complex comprising an HPV16-E7 peptide and an MHC class I protein, wherein the isolated anti-E7MC construct further comprises a second antigen- binding moiety that specifically binds to a second antigen. In some embodiments, the second antigen-binding moiety is an antibody moiety. In some embodiments, the second antigen is an antigen on the surface of a T cell. In some embodiments, the T cell is selected from the group consisting of a cytotoxic T cell, a helper T cell, and a natural killer T cell. In some embodiments, the second antigen is selected from the group consisting of CD3y, CD35,
CD38, CD3C, CD28, OX40, GITR, CD137, CD27, CD40L, and HVEM. In some
embodiments, the second antigen is CD3s, and the isolated anti-E7MC construct is a tandem scFv comprising an N-terminal scFv specific for the HPV16-E7/MHC class I complex and a C-terminal scFv specific for CD3s. In some embodiments, the second antigen is an antigen on the surface of a natural killer cell, a neutrophil, a monocyte, a macrophage, or a dendritic cell.
[0023] In some embodiments, according to any of the anti-E7MC constructs (such as isolated anti-E7MC constructs) described above, the anti-E7MC construct comprises an antibody moiety that specifically binds to a complex comprising an HPV16-E7 peptide and an MHC class I protein, wherein the isolated anti-E7MC construct is a chimeric antigen receptor (CAR). In some embodiments, the chimeric antigen receptor comprises an extracellular domain comprising the antibody moiety, a transmembrane domain, and an intracellular signaling domain. In some embodiments, the intracellular signaling domain comprises a CD3ζ intracellular signaling sequence and a co- stimulatory signaling sequence. In some embodiments, the co-stimulatory signaling sequence is a CD28 intracellular signaling sequence.
[0024] In some embodiments, according to any of the anti-E7MC constructs (such as isolated anti-E7MC constructs) described above, the anti-E7MC construct comprises an antibody moiety that specifically binds to a complex comprising an HPV16-E7 peptide and an MHC class I protein, wherein the isolated anti-E7MC construct is an immunoconjugate comprising the antibody moiety and an effector molecule. In some embodiments, the effector molecule is a therapeutic agent selected from the group consisting of a drug, a toxin, a radioisotope, a protein, a peptide, and a nucleic acid. In some embodiments, the therapeutic agent is a drug or a toxin. In some embodiments, the effector molecule is a label.
[0025] In yet other embodiments, there is provided a pharmaceutical composition comprising an anti-E7MC construct (such as an isolated anti-E7MC construct) according to any of the embodiments described above. In some embodiments, the pharmaceutical composition further comprises a cell (such as an effector cell) associated with the anti-E7MC construct. In some embodiments, there is provided a host cell expressing or associated with an anti-E7MC construct, or polypeptide component thereof. In some embodiments, there is provided a nucleic acid encoding an anti-E7MC construct, or polypeptide component thereof. In some embodiments, there is provided a vector comprising the nucleic acid. In some embodiments, there is provided an effector cell expressing or associated with an anti-E7MC construct. In some embodiments, the effector cell is a T cell.
[0026] In some embodiments, there is provided a method of detecting a cell presenting a complex comprising an HPV16-E7 peptide and an MHC class I protein on its surface, comprising contacting the cell with an anti-E7MC construct (such as an isolated anti-E7MC construct) according to any of the embodiments described above comprising a) an antibody moiety that specifically binds to a complex comprising the HPV16-E7 peptide and the MHC class I protein and b) a label, and detecting the presence of the label on the cell.
[0027] In some embodiments, there is provided a method of treating an individual having an HPV16-E7-positive disease, comprising administering to the individual an effective amount of a pharmaceutical composition comprising an anti-E7MC construct (such as an isolated anti-E7MC construct) according to any of the embodiments described above. In some embodiments, the pharmaceutical composition further comprises a cell (such as an effector cell) associated with the isolated anti-E7MC construct. In some embodiments, there is provided a method of treating an individual having an HPV16-E7-positive disease, comprising administering to the individual an effective amount of an effector cell expressing any of the anti-E7MC CARs described above. In some embodiments, the effector cell is a T cell. In some embodiments, the HPV16-E7-positive disease is cancer. In some embodiments, the cancer is squamous cell carcinoma, cervical cancer, anal cancer, vaginal cancer, vulvar cancer, penile cancer, head and neck cancer, or oropharyngeal cancer. In some embodiments, the cancer is an HPV16-E7-positive squamous cell carcinoma (SCC).
[0028] In some embodiments, there is provided a method of diagnosing an individual having an HPV16-E7-positive disease, comprising: a) administering an effective amount of an isolated anti-E7MC construct comprising a label according to any of the embodiments described above to the individual; and b) determining the level of the label in the individual, wherein a level of the label above a threshold level indicates that the individual has the
HPV16-E7-positive disease. In some embodiments, there is provided a method of diagnosing an individual having an HPV16-E7-positive disease, comprising: a) contacting a sample derived from the individual with an isolated anti-E7MC construct comprising a label according to any of the embodiments described above; and b) determining the number of cells bound with the isolated anti-E7MC construct in the sample, wherein a value for the number of cells bound with the isolated anti-E7MC construct above a threshold level indicates that the individual has the HPV16-E7-positive disease. In some embodiments, the
HPV16-E7-positive disease is cancer. In some embodiments, the cancer is squamous cell carcinoma, cervical cancer, anal cancer, vaginal cancer, vulvar cancer, penile cancer, head
and neck cancer, or oropharyngeal cancer. In some embodiments, the cancer is an HPV16- E7-positive squamous cell carcinoma (SCC).
[0029] Also provided are methods of making any of the constructs described herein, articles of manufacture, and kits that are suitable for the methods described herein.
BRIEF DESCRIPTION OF THE DRAWINGS
[0030] FIG. 1 shows the size exclusion chromatography (SEC) chromatogram of HPV16-E7 11-19 peptide/HLA-A*02:01 complex following concentration by ultrafiltration. Properly folded peptide/MHC complex monomers: 212 mL; misfolded aggregates: 111 mL; free β2Μ: 267 mL.
[0031] FIG. 2 shows the results of phage clone ELIS A for specific binding of biotinylated HPV16-E7 11-19 peptide/HLA-A*02:01 versus biotinylated C3 control peptide/HLA- A*02:01.
[0032] FIG. 3 shows the results of phage clone FACS binding assays for binding of HPV16- E7 11-19 peptide-loaded T2 cells versus C3 control peptide-loaded T2 cells. 1: Cell only negative control; 2: 2° antibody only control; 3: HPV16-E7 11-19 peptide/HLA-A*02:01- specific antibody phage clone.
[0033] FIG. 4 shows the results of phage clone #11 FACS binding assays for T2 cells loaded with HPV16-E7 11-19 peptides having a single alanine substitution at position 1, 5, or 8. 1: Cell only negative control; 2: 2° antibody only control; 3: HPV16-E7 11-19 peptide/HLA- A*02:01 -specific antibody phage clone #11.
[0034] FIG. 5 shows the results of phage clone FACS binding assays for binding of HPV16- E7 11-19 peptide-loaded T2 cells versus T2 cells loaded with peptides derived from normally expressed endogenous proteins. For each phage clone, the peptides loaded from left to right are HPV16-E7 11-19, A2E1, A2E2, A2E3, A2E4, A2E5, A2E6, A2E7, A2E8, A2E9, A2E11, and A2E17.
[0035] FIG. 6 shows SDS-PAGE analysis for determining purity of anti-HPV16-E7 11- 19/MHC bispecific antibodies.
[0036] FIG. 7 shows the T-cell killing of HPV16-E7 11-19 peptide-loaded T2 cells mediated by anti-HPV16-E7 11-19/HLA-A*02:01 bispecific antibodies prepared from various phage clones at 1 μg/ml and 0.2 μg/ml. Negative controls include T2 cells loaded with AFP158 peptide and bispecific antibody specific for AFP158/HLA-A*02:01. For each phage clone,
the peptides loaded from left to right are 1 μg/ml HPV16-E7 11-19, 1 μg/ml AFP158, 0.2 μg/ml HPV16-E7 11-19, and 0.2 μg/ml AFP158. NC peptide: AFP158 peptide; NC
Antibody: anti-AFP158/HLA-A*02:01 bispecific antibody.
[0037] FIG. 8A shows the T-cell killing of two cancer cell lines (CaSki and MS-751) mediated by anti-HPV16-E7 11-19/MHC bispecific antibodies (BsAb).
[0038] FIG. 8B shows the dose-dependence for T-cell killing of two cancer cell lines (CaSki and MS-751) mediated by anti-HPV16-E7 11-19/MHC bispecific antibodies (BsAb) at varying BsAb concentrations.
[0039] FIG. 9 shows a schematic representation of a chimeric antigen receptor construct.
[0040] FIGS. 10A and 10B show the results of BsAb FACS binding assays for T2 cells loaded with HPV16-E7 11-19 peptides having a WT sequence or a single alanine substitution at positions 1-9. FIG. 10A shows results for BsAbs based on clones US-7, 7-1, 7-3, and 7-6. FIG. 10B shows results for BsAbs based on clones 7-7 and 7-8.
[0041] FIGS. 1 lA-11C show flow cytometry analysis of T cells transduced with various CARs having an anti-HPV16-E7 affinity matured or parental scFv; cells were stained with HPV16-E7 11-19 peptide /HLA-A*02:01 tetramers and co-stained with anti-CD4 antibody and anti-CD8 antibody. FIG. 11A shows flow cytometry analysis for US-7 4- IBB, 7-1 4- 1BB, 7-3 4-1BB, 7-6 4-1BB, 7-7 4-1BB, and 7-8 4-1BB CAR-T cells. FIG. 11B shows flow cytometry analysis for 7-9 4-1BB, US-7 CD28, 7-1 CD28, 7-3 CD28, 7-6 CD28, and 7-7 CD28 CAR-T cells. FIG. 11C show flow cytometry analysis for 7-8 CD28 and 7-9 CD28 CAR-T cells, and mock- transduced T cells.
[0042] FIG. 12 shows the killing of cancer cell lines positive for HLA-A*02:01 and either positive or negative for HPV16-E7, mediated by T cells expressing an anti-HPV16-E7/HLA- A*02:01 CAR having an affinity matured or parental scFv. Mock-transduced cells were included as controls.
DETAILED DESCRIPTION OF THE INVENTION
[0043] The present application provides isolated constructs (referred to herein as "anti-E7MC constructs") that comprise an antibody moiety (referred to herein as an "anti-E7MC antibody moiety") that specifically binds to a complex comprising an HPV16-E7 peptide and an MHC class I protein (referred to herein as an "HPV16-E7/MHC class I complex," or "E7MC"). The anti-E7MC constructs specifically recognize HPV16-E7/MHC class I complexes, such as
MHC-presented HPV16-E7 peptides on the surface of cells expressing HPV16-E7. Anti- E7MC constructs may specifically bind to the N-terminal portion, the C-terminal portion, or the middle portion of the HPV16-E7 peptide in the complex, and/or cross-react with at least one complex comprising the HPV16-E7 peptide and a different subtype of the MHC class I protein (e.g. , the anti-E7MC construct binds to both an HPV16-E7 peptide/HLA-A*02:01 complex and an HPV16-E7 peptide/HLA-A*02:02 complex). The anti-E7MC constructs allow for specific targeting of E7MC-presenting cells (i.e. , cells presenting on their surface an HPV16-E7 peptide bound to an MHC molecule), such as disease cells expressing HPV16-E7. This strategy provides a significant technical advantage over using antibodies directed against the HPV16-E7 protein, which cannot specifically target E7MC-presenting cells. Furthermore, when fused to a detectable moiety, the anti-E7MC antibody moiety allows for diagnosis and prognosis of HPV16-E7-positive diseases or disorders with high sensitivity to changes in the number and distribution of E7MC-presenting cells, a potentially more relevant measure of disease progression than circulating HPV16-E7 levels.
[0044] Using phage display technology, we generated multiple monoclonal antibodies that are specific and high affinity against HPV16-E7 1 1-19 peptide/HLA-A*02:01 complex. Flow cytometry and T-cell mediated cytotoxicity assays demonstrated that the antibodies recognized HPV16-E7 peptide-pulsed T2 cells in an HPV16-E7- and HLA-A*02:01- restricted manner. When armed as anti-CD3 bispecific antibodies, the antibodies re-directed human T cells to kill HPV16-E7-positive and HLA-A*02:01 -positive target cells. The data presented herein demonstrate that antibodies against HPV16-E7 peptides in the context of an HLA complex can be effective therapeutic agents for cancer indications, such as solid tumor indications.
[0045] The present application thus provides constructs (such as isolated constructs) comprising an antibody moiety that specifically binds to a complex comprising an HPV16-E7 peptide and an MHC class I protein. The construct can be, for example, a full-length anti- E7MC antibody, a multi- specific anti-E7MC molecule (such as a bispecific anti-E7MC antibody), an anti-E7MC chimeric antigen receptor ("CAR"), or an anti-E7MC
immunoconj ugate .
[0046] In another aspect, there are provided nucleic acids encoding the anti-E7MC constructs or the anti-E7MC antibody moiety portion of the constructs.
[0047] In another aspect, there are provided compositions comprising an anti-E7MC construct comprising an antibody moiety that specifically binds to a complex comprising an
HPV16-E7-peptide and an MHC class I protein. The composition can be a pharmaceutical composition comprising an anti-E7MC construct or an effector cell expressing or associated with the anti-E7MC construct (for example a T cell expressing an anti-E7MC CAR).
[0048] Also provided are methods of making and using the anti-E7MC constructs (or cells expressing or associated with the anti-E7MC constructs) for treatment or diagnostic purposes, as well as kits and articles of manufacture useful for such methods.
Definitions
[0049] As used herein, "treatment" or "treating" is an approach for obtaining beneficial or desired results, including clinical results. For purposes of this invention, beneficial or desired clinical results include, but are not limited to, one or more of the following: alleviating one or more symptoms resulting from the disease, diminishing the extent of the disease, stabilizing the disease (e.g. , preventing or delaying the worsening of the disease), preventing or delaying the spread (e.g. , metastasis) of the disease, preventing or delaying the recurrence of the disease, delay or slowing the progression of the disease, ameliorating the disease state, providing a remission (partial or total) of the disease, decreasing the dose of one or more other medications required to treat the disease, delaying the progression of the disease, increasing or improving the quality of life, increasing weight gain, and/or prolonging survival. Also encompassed by "treatment" is a reduction of pathological consequence of cancer (such as, for example, tumor volume). The methods of the invention contemplate any one or more of these aspects of treatment.
[0050] The terms "recurrence," "relapse" or "relapsed" refers to the return of a cancer or disease after clinical assessment of the disappearance of disease. A diagnosis of distant metastasis or local recurrence can be considered a relapse.
[0051] The term "refractory" or "resistant" refers to a cancer or disease that has not responded to treatment.
[0052] "Activation", as used herein in relation to T cells, refers to the state of a T cell that has been sufficiently stimulated to induce detectable cellular proliferation. Activation can also be associated with induced cytokine production, and detectable effector functions.
[0053] The term "antibody moiety" includes full-length antibodies and antigen-binding fragments thereof. A full-length antibody comprises two heavy chains and two light chains. The variable regions of the light and heavy chains are responsible for antigen binding. The variables region in both chains generally contain three highly variable loops called the
complementarity determining regions (CDRs) (light chain (LC) CDRs including LC-CDR1, LC-CDR2, and LC-CDR3, heavy chain (HC) CDRs including HC-CDR1, HC-CDR2, and HC-CDR3). CDR boundaries for the antibodies and antigen-binding fragments disclosed herein may be defined or identified by the conventions of Kabat, Chothia, or Al-Lazikani (Al- Lazikani 1997; Chothia 1985; Chothia 1987; Chothia 1989; Kabat 1987; Kabat 1991). The three CDRs of the heavy or light chains are interposed between flanking stretches known as framework regions (FRs), which are more highly conserved than the CDRs and form a scaffold to support the hypervariable loops. The constant regions of the heavy and light chains are not involved in antigen binding, but exhibit various effector functions. Antibodies are assigned to classes based on the amino acid sequence of the constant region of their heavy chain. The five major classes or isotypes of antibodies are IgA, IgD, IgE, IgG, and IgM, which are characterized by the presence of α, δ, ε, γ, and μ heavy chains, respectively.
Several of the major antibody classes are divided into subclasses such as lgGl (γΐ heavy chain), lgG2 (γ2 heavy chain), lgG3 (γ3 heavy chain), lgG4 (γ4 heavy chain), IgAl (al heavy chain), or lgA2 (a2 heavy chain).
[0054] The term "antigen-binding fragment" as used herein refers to an antibody fragment including, for example, a diabody, a Fab, a Fab', a F(ab')2, an Fv fragment, a disulfide stabilized Fv fragment (dsFv), a (dsFv)2, a bispecific dsFv (dsFv-dsFv'), a disulfide stabilized diabody (ds diabody), a single-chain antibody molecule (scFv), an scFv dimer (bivalent diabody), a multispecific antibody formed from a portion of an antibody comprising one or more CDRs, a camelized single domain antibody, a nanobody, a domain antibody, a bivalent domain antibody, or any other antibody fragment that binds to an antigen but does not comprise a complete antibody structure. An antigen-binding fragment is capable of binding to the same antigen to which the parent antibody or a parent antibody fragment (e.g. , a parent scFv) binds. In some embodiments, an antigen-binding fragment may comprise one or more CDRs from a particular human antibody grafted to a framework region from one or more different human antibodies.
[0055] The term "epitope" as used herein refers to the specific group of atoms or amino acids on an antigen to which an antibody or antibody moiety binds. Two antibodies or antibody moieties may bind the same epitope within an antigen if they exhibit competitive binding for the antigen.
[0056] As used herein, a first antibody moiety "competes" for binding to a target E7MC with a second antibody moiety when the first antibody moiety inhibits target E7MC binding of the
second antibody moiety by at least about 50% (such as at least about any of 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 98% or 99%) in the presence of an equimolar
concentration of the first antibody moiety, or vice versa. A high throughput process for "binning" antibodies based upon their cross-competition is described in PCT Publication No. WO 03/48731.
[0057] As use herein, the term "specifically binds" or "is specific for" refers to measurable and reproducible interactions, such as binding between a target and an antibody or antibody moiety, that is determinative of the presence of the target in the presence of a heterogeneous population of molecules, including biological molecules. For example, an antibody or antibody moiety that specifically binds to a target (which can be an epitope) is an antibody or antibody moiety that binds this target with greater affinity, avidity, more readily, and/or with greater duration than its bindings to other targets. In some embodiments, an antibody or antibody moiety that specifically binds to an antigen reacts with one or more antigenic determinants of the antigen (for example an HPV16-E7 peptide/MHC class I protein complex) with a binding affinity that is at least about 10 times its binding affinity for other targets.
[0058] An "isolated" anti-E7MC construct as used herein refers to an anti-E7MC construct that (1) is not associated with proteins found in nature, (2) is free of other proteins from the same source, (3) is expressed by a cell from a different species, or, (4) does not occur in nature.
[0059] The term "isolated nucleic acid" as used herein is intended to mean a nucleic acid of genomic, cDNA, or synthetic origin or some combination thereof, which by virtue of its origin the "isolated nucleic acid" (1) is not associated with all or a portion of a polynucleotide in which the "isolated nucleic acid" is found in nature, (2) is operably linked to a
polynucleotide which it is not linked to in nature, or (3) does not occur in nature as part of a larger sequence.
[0060] As used herein, the term "CDR" or "complementarity determining region" is intended to mean the non-contiguous antigen combining sites found within the variable region of both heavy and light chain polypeptides. These particular regions have been described by Kabat et al, J. Biol. Chem. 252:6609-6616 (1977); Kabat et al, U.S. Dept. of Health and Human
Services, "Sequences of proteins of immunological interest" (1991); by Chothia et ah, J. Mol.
Biol. 196:901-917 (1987); and MacCallum et al, J. Mol. Biol. 262:732-745 (1996), where the definitions include overlapping or subsets of amino acid residues when compared against
each other. Nevertheless, application of either definition to refer to a CDR of an antibody or grafted antibodies or variants thereof is intended to be within the scope of the term as defined and used herein. The amino acid residues which encompass the CDRs as defined by each of the above cited references are set forth below in Table 1 as a comparison.
TABLE 1: CDR DEFINITIONS
Kabat1 Chothia2 MacCallum3
VH CDRI 31-35 26-32 30-35
VH CDR2 50-65 53-55 47-58
VH CDR3 95- 102 96- 101 93- 101
VL CDR1 24-34 26-32 30-36
VL CDR2 50-56 50-52 46-55
VL CDR3 89-97 91-96 89-96
Residue numbering follows the nomenclature of Kabat et al., supra
2Residue numbering follows the nomenclature of Chothia et al, supra
3Residue numbering follows the nomenclature of MacCallum et al., supra
[0061] The term "chimeric antibodies" refer to antibodies in which a portion of the heavy and/or light chain is identical with or homologous to corresponding sequences in antibodies derived from a particular species or belonging to a particular antibody class or subclass, while the remainder of the chain(s) is identical with or homologous to corresponding sequences in antibodies derived from another species or belonging to another antibody class or subclass, as well as fragments of such antibodies, so long as they exhibit a biological activity of this invention (see U.S. Patent No. 4,816,567; and Morrison et al., Proc. Natl. Acad. Sci. USA, 81 :6851-6855 (1984)).
[0062] The term "semi- synthetic" in reference to an antibody or antibody moiety means that the antibody or antibody moiety has one or more naturally occurring sequences and one or more non-naturally occurring {i.e., synthetic) sequences.
[0063] "Fv" is the minimum antibody fragment which contains a complete antigen- recognition and -binding site. This fragment consists of a dimer of one heavy- and one light- chain variable region domain in tight, non-covalent association. From the folding of these two domains emanate six hypervariable loops (3 loops each from the heavy and light chain) that contribute the amino acid residues for antigen binding and confer antigen binding specificity to the antibody. However, even a single variable domain (or half of an Fv
comprising only three CDRs specific for an antigen) has the ability to recognize and bind antigen, although at a lower affinity than the entire binding site.
[0064] "Single-chain Fv," also abbreviated as "sFv" or "scFv," are antibody fragments that comprise the VJJ and VL antibody domains connected into a single polypeptide chain. In some embodiments, the scFv polypeptide further comprises a polypeptide linker between the Vfj and VL domains which enables the scFv to form the desired structure for antigen binding. For a review of scFv, see Pluckthun in The Pharmacology of Monoclonal
Antibodies, vol. 113, Rosenburg and Moore eds., Springer- Verlag, New York, pp. 269-315 (1994).
[0065] The term "diabodies" refers to small antibody fragments prepared by constructing scFv fragments (see preceding paragraph) typically with short linkers (such as about 5 to about 10 residues) between the VJJ and VL domains such that inter-chain but not intra-chain pairing of the V domains is achieved, resulting in a bivalent fragment, i.e., fragment having two antigen-binding sites. Bispecific diabodies are heterodimers of two "crossover" scFv fragments in which the VJJ and VL domains of the two antibodies are present on different polypeptide chains. Diabodies are described more fully in, for example, EP 404,097; WO 93/11161; and Hollinger et al, Proc. Natl. Acad. Sci. USA, 90:6444-6448 (1993).
[0066] "Humanized" forms of non-human (e.g., rodent) antibodies are chimeric antibodies that contain minimal sequence derived from the non-human antibody. For the most part, humanized antibodies are human immunoglobulins (recipient antibody) in which residues from a hypervariable region (HVR) of the recipient are replaced by residues from a hypervariable region of a non-human species (donor antibody) such as mouse, rat, rabbit or non-human primate having the desired antibody specificity, affinity, and capability. In some instances, framework region (FR) residues of the human immunoglobulin are replaced by corresponding non-human residues. Furthermore, humanized antibodies can comprise residues that are not found in the recipient antibody or in the donor antibody. These modifications are made to further refine antibody performance. In general, the humanized antibody will comprise substantially all of at least one, and typically two, variable domains, in which all or substantially all of the hypervariable loops correspond to those of a non- human immunoglobulin and all or substantially all of the FRs are those of a human immunoglobulin sequence. The humanized antibody optionally also will comprise at least a portion of an immunoglobulin constant region (Fc), typically that of a human
immunoglobulin. For further details, see Jones et ah, Nature 321:522-525 (1986); Riechmann et al, Nature 332:323-329 (1988); and Presta, Curr. Op. Struct. Biol. 2:593-596 (1992).
[0067] "Percent (%) amino acid sequence identity" or "homology" with respect to the polypeptide and antibody sequences identified herein is defined as the percentage of amino acid residues in a candidate sequence that are identical with the amino acid residues in the polypeptide being compared, after aligning the sequences considering any conservative substitutions as part of the sequence identity. Alignment for purposes of determining percent amino acid sequence identity can be achieved in various ways that are within the skill in the art, for instance, using publicly available computer software such as BLAST, BLAST-2, ALIGN, Megalign (DNASTAR), or MUSCLE software. Those skilled in the art can determine appropriate parameters for measuring alignment, including any algorithms needed to achieve maximal alignment over the full-length of the sequences being compared. For purposes herein, however, % amino acid sequence identity values are generated using the sequence comparison computer program MUSCLE (Edgar, R.C., Nucleic Acids Research 32(5): 1792-1797, 2004; Edgar, R.C., BMC Bioinformatics 5(1): 113, 2004).
[0068] The terms "Fc receptor" or "FcR" are used to describe a receptor that binds to the Fc region of an antibody. In some embodiments, an FcR of this invention is one that binds an IgG antibody (a γ receptor) and includes receptors of the FcyRI, FcyRII, and FcyRIII subclasses, including allelic variants and alternatively spliced forms of these receptors.
FcyRII receptors include FcyRIIA (an "activating receptor") and FcyRIIB (an "inhibiting receptor"), which have similar amino acid sequences that differ primarily in the cytoplasmic domains thereof. Activating receptor FcyRIIA contains an immunoreceptor tyrosine-based activation motif (IT AM) in its cytoplasmic domain. Inhibiting receptor FcyRIIB contains an immunoreceptor tyrosine-based inhibition motif (ITIM) in its cytoplasmic domain (see review M. in Daeron, Annu. Rev. Immunol. 15:203-234 (1997)). The term includes allotypes, such as FcyRIIIA allotypes: FcYRIIIA-Phel58, FcYRIIIA-Vall58, FcyRIIA-R131 and/or FCYRIIA-H131. FCRS are reviewed in Ravetch and Kinet, Annu. Rev. Immunol 9:457-92 (1991); Capel et ah, Immunomethods 4:25-34 (1994); and de Haas et ah, J. Lab. Clin. Med. 126:330-41 (1995). Other FcRs, including those to be identified in the future, are
encompassed by the term "FcR" herein. The term also includes the neonatal receptor, FcRn, which is responsible for the transfer of maternal IgGs to the fetus (Guyer et ah, J. Immunol. 117:587 (1976) and Kim et al, J. Immunol . 24:249 (1994)).
[0069] The term "FcRn" refers to the neonatal Fc receptor (FcRn). FcRn is structurally similar to major histocompatibility complex (MHC) and consists of an a-chain noncovalently bound to P2-microglobulin. The multiple functions of the neonatal Fc receptor FcRn are reviewed in Ghetie and Ward (2000) Annu. Rev. Immunol. 18, 739-766. FcRn plays a role in the passive delivery of immunoglobulin IgGs from mother to young and the regulation of serum IgG levels. FcRn can act as a salvage receptor, binding and transporting pinocytosed IgGs in intact form both within and across cells, and rescuing them from a default degradative pathway.
[0070] The "CHI domain" of a human IgG Fc region (also referred to as "CI" of "HI" domain) usually extends from about amino acid 118 to about amino acid 215 (EU numbering system).
[0071] "Hinge region" is generally defined as stretching from Glu216 to Pro230 of human IgGl (Burton, Molec. Immunol.22: l6l-206 (1985)). Hinge regions of other IgG isotypes may be aligned with the IgGl sequence by placing the first and last cysteine residues forming inter-heavy chain S-S bonds in the same positions.
[0072] The "CH2 domain" of a human IgG Fc region (also referred to as "C2" of "H2" domain) usually extends from about amino acid 231 to about amino acid 340. The CH2 domain is unique in that it is not closely paired with another domain. Rather, two N-linked branched carbohydrate chains are interposed between the two CH2 domains of an intact native IgG molecule. It has been speculated that the carbohydrate may provide a substitute for the domain-domain pairing and help stabilize the CH2 domain. Burton, Molec Immunol. 22: 161-206 (1985).
[0073] The "CH3 domain" (also referred to as "C2" or "H3" domain) comprises the stretch of residues C-terminal to a CH2 domain in an Fc region {i.e. from about amino acid residue 341 to the C-terminal end of an antibody sequence, typically at amino acid residue 446 or 447 of an IgG).
[0074] A "functional Fc fragment" possesses an "effector function" of a native sequence Fc region. Exemplary "effector functions" include Clq binding; complement dependent cytotoxicity (CDC); Fc receptor binding; antibody-dependent cell-mediated cytotoxicity (ADCC); phagocytosis; down regulation of cell surface receptors {e.g. B cell receptor; BCR), etc. Such effector functions generally require the Fc region to be combined with a binding
domain (e.g. an antibody variable domain) and can be assessed using various assays known in the art.
[0075] An antibody with a variant IgG Fc with "altered" FcR binding affinity or ADCC activity is one which has either enhanced or diminished FcR binding activity (e.g., FcyR or FcRn) and/or ADCC activity compared to a parent polypeptide or to a polypeptide comprising a native sequence Fc region. The variant Fc which "exhibits increased binding" to an FcR binds at least one FcR with higher affinity (e.g., lower apparent Kd or IC50 value) than the parent polypeptide or a native sequence IgG Fc. According to some embodiments, the improvement in binding compared to a parent polypeptide is about 3 fold, such as about any of 5, 10, 25, 50, 60, 100, 150, 200, or up to 500 fold, or about 25% to 1000% improvement in binding. The polypeptide variant which "exhibits decreased binding" to an FcR, binds at least one FcR with lower affinity (e.g., higher apparent Kd or higher IC50 value) than a parent polypeptide. The decrease in binding compared to a parent polypeptide may be about 40% or more decrease in binding.
[0076] "Antibody-dependent cell-mediated cytotoxicity" or "ADCC" refers to a form of cytotoxicity in which secreted Ig bound to Fc receptors (FcRs) present on certain cytotoxic cells (e.g. Natural Killer (NK) cells, neutrophils, and macrophages) enable these cytotoxic effector cells to bind specifically to an antigen-bearing target cell and subsequently kill the target cell with cytotoxins. The antibodies "arm" the cytotoxic cells and are absolutely required for such killing. The primary cells for mediating ADCC, NK cells, express FcyRIII only, whereas monocytes express FcyRI, FcyRII and FcyRIII. FcR expression on
hematopoietic cells is summarized in Table 3 on page 464 of Ravetch and Kinet, Annu. Rev. Immunol 9:457-92 (1991). To assess ADCC activity of a molecule of interest, an in vitro ADCC assay, such as that described in US Patent No. 5,500,362 or 5,821,337 may be performed. Useful effector cells for such assays include peripheral blood mononuclear cells (PBMC) and Natural Killer (NK) cells. Alternatively, or additionally, ADCC activity of the molecule of interest may be assessed in vivo, e.g., in an animal model such as that disclosed in Clynes et al. PNAS (USA) 95:652-656 (1998).
[0077] The polypeptide comprising a variant Fc region which "exhibits increased ADCC" or mediates antibody-dependent cell-mediated cytotoxicity (ADCC) in the presence of human effector cells more effectively than a polypeptide having wild type IgG Fc or a parent polypeptide is one which in vitro or in vivo is substantially more effective at mediating
ADCC, when the amounts of polypeptide with variant Fc region and the polypeptide with
wild type Fc region (or the parent polypeptide) in the assay are essentially the same.
Generally, such variants will be identified using any in vitro ADCC assay known in the art, such as assays or methods for determining ADCC activity, e.g. in an animal model etc. In some embodiments, the variant is from about 5 fold to about 100 fold, e.g. from about 25 to about 50 fold, more effective at mediating ADCC than the wild type Fc (or parent polypeptide) .
[0078] "Complement dependent cytotoxicity" or "CDC" refers to the lysis of a target cell in the presence of complement. Activation of the classical complement pathway is initiated by the binding of the first component of the complement system (Clq) to antibodies (of the appropriate subclass) which are bound to their cognate antigen. To assess complement activation, a CDC assay, e.g. as described in Gazzano-Santoro et ah, J. Immunol. Methods 202: 163 (1996), may be performed. Polypeptide variants with altered Fc region amino acid sequences and increased or decreased Clq binding capability are described in US patent No. 6,194,551B 1 and W099/51642. The contents of those patent publications are specifically incorporated herein by reference. See, also, Idusogie et al. J. Immunol. 164: 4178-4184 (2000).
[0079] Unless otherwise specified, a "nucleotide sequence encoding an amino acid sequence" includes all nucleotide sequences that are degenerate versions of each other and that encode the same amino acid sequence. The phrase nucleotide sequence that encodes a protein or an RNA may also include introns to the extent that the nucleotide sequence encoding the protein may in some version contain an intron(s).
[0080] The term "operably linked" refers to functional linkage between a regulatory sequence and a heterologous nucleic acid sequence resulting in expression of the latter. For example, a first nucleic acid sequence is operably linked with a second nucleic acid sequence when the first nucleic acid sequence is placed in a functional relationship with the second nucleic acid sequence. For instance, a promoter is operably linked to a coding sequence if the promoter affects the transcription or expression of the coding sequence. Generally, operably linked DNA sequences are contiguous and, where necessary to join two protein coding regions, in the same reading frame.
[0081] "Homologous" refers to the sequence similarity or sequence identity between two polypeptides or between two nucleic acid molecules. When a position in both of the two compared sequences is occupied by the same base or amino acid monomer subunit, e.g., if a position in each of two DNA molecules is occupied by adenine, then the molecules are
homologous at that position. The percent of homology between two sequences is a function of the number of matching or homologous positions shared by the two sequences divided by the number of positions compared times 100. For example, if 6 of 10 of the positions in two sequences are matched or homologous then the two sequences are 60% homologous. By way of example, the DNA sequences ATTGCC and TATGGC share 50% homology. Generally, a comparison is made when two sequences are aligned to give maximum homology.
[0082] An "effective amount" of an anti-E7MC construct or composition as disclosed herein, is an amount sufficient to carry out a specifically stated purpose. An "effective amount" can be determined empirically and by known methods relating to the stated purpose.
[0083] The term "therapeutically effective amount" refers to an amount of an anti-E7MC construct or composition as disclosed herein, effective to "treat" a disease or disorder in an individual. In the case of cancer, the therapeutically effective amount of the anti-E7MC construct or composition as disclosed herein can reduce the number of cancer cells; reduce the tumor size or weight; inhibit (i.e. , slow to some extent and preferably stop) cancer cell infiltration into peripheral organs; inhibit (i.e. , slow to some extent and preferably stop) tumor metastasis; inhibit, to some extent, tumor growth; and/or relieve to some extent one or more of the symptoms associated with the cancer. To the extent the anti-E7MC construct or composition as disclosed herein can prevent growth and/or kill existing cancer cells, it can be cytostatic and/or cytotoxic. In some embodiments, the therapeutically effective amount is a growth inhibitory amount. In some embodiments, the therapeutically effective amount is an amount that extends the survival of a patient. In some embodiments, the therapeutically effective amount is an amount that improves progression free survival of a patient.
[0084] As used herein, by "pharmaceutically acceptable" or "pharmacologically compatible" is meant a material that is not biologically or otherwise undesirable, e.g. , the material may be incorporated into a pharmaceutical composition administered to a patient without causing any significant undesirable biological effects or interacting in a deleterious manner with any of the other components of the composition in which it is contained. Pharmaceutically acceptable carriers or excipients have preferably met the required standards of toxicological and manufacturing testing and/or are included on the Inactive Ingredient Guide prepared by the U.S. Food and Drug administration.
[0085] The term "label" when used herein refers to a detectable compound or composition which can be conjugated directly or indirectly to the anti-E7MC antibody moiety. The label may be detectable by itself (e.g., radioisotope labels or fluorescent labels) or, in the case of an
enzymatic label, may catalyze chemical alteration of a substrate compound or composition which is detectable.
[0086] It is understood that embodiments of the invention described herein include
"consisting" and/or "consisting essentially of embodiments.
[0087] Reference to "about" a value or parameter herein includes (and describes) variations that are directed to that value or parameter per se. For example, description referring to "about X" includes description of "X".
[0088] As used herein, reference to "not" a value or parameter generally means and describes "other than" a value or parameter. For example, the method is not used to treat cancer of type X means the method is used to treat cancer of types other than X.
[0089] As used herein and in the appended claims, the singular forms "a," "or," and "the" include plural referents unless the context clearly dictates otherwise.
Anti-E7MC constructs
[0090] In one aspect, the present invention provides HPV16-E7/MHC class I complex- specific constructs (anti-E7MC constructs) that comprise an antibody moiety that specifically binds to a complex comprising an HPV16-E7 peptide and an MHC class I protein ("HPV16- E7/MHC class I complex," or "E7MC"). The specificity of the anti-E7MC construct derives from an anti-E7MC antibody moiety, such as a full-length antibody or antigen-binding fragment thereof, that specifically binds to the E7MC. In some embodiments, reference to a moiety (such as an antibody moiety) that specifically binds to a complex comprising an HPV16-E7 peptide and an MHC class I protein means that the moiety binds to the E7MC with a) an affinity that is at least about 10 (including for example at least about any of 10, 20, 30, 40, 50, 75, 100, 200, 300, 400, 500, 750, 1000 or more) times its binding affinity for each of full-length HPV16-E7, free HPV16-E7 peptide, MHC class I protein not bound to a peptide, and MHC class I protein bound to a non-HPV16-E7 peptide; or b) a Kd no more than about 1/10 (such as no more than about any of 1/10, 1/20, 1/30, 1/40, 1/50, 1/75, 1/100, 1/200, 1/300, 1/400, 1/500, 1/750, 1/1000 or less) times its Kd for binding to each of full- length HPV16-E7, free HPV16-E7 peptide, MHC class I protein not bound to a peptide, and MHC class I protein bound to a non-HPV16-E7 peptide. Binding affinity can be determined by methods known in the art, such as ELISA, fluorescence activated cell sorting (FACS) analysis, or radioimmunoprecipitation assay (RIA). Kd can be determined by methods known in the art, such as surface plasmon resonance (SPR) assay utilizing, for example, Biacore
instruments, or kinetic exclusion assay (KinExA) utilizing, for example, Sapidyne instruments.
[0091] Contemplated anti-E7MC constructs include, for example, full-length anti-E7MC antibodies, multi- specific (such as bispecific) anti-E7MC molecules, anti-E7MC chimeric antigen receptors (CARs), and anti-E7MC immunoconjugates.
[0092] For example, in some embodiments, there is provided an anti-E7MC construct (such as an isolated anti-E7MC construct) comprising an anti-E7MC antibody moiety that specifically binds to a complex comprising an HPV16-E7 peptide and an MHC class I protein. In some embodiments, the HPV16-E7 peptide is HPV16-E7 11-19 (SEQ ID NO: 4). In some embodiments, the MHC class I protein is HLA-A02. In some embodiments, the MHC class I protein is HLA-A*02:01 (GenBank Accession No.: AAO20853). In some embodiments, the anti-E7MC construct is non-naturally occurring. In some embodiments, the anti-E7MC construct is a full-length antibody. In some embodiments, the anti-E7MC construct is a multi- specific (such as bispecific) molecule. In some embodiments, the anti- E7MC construct is a chimeric antigen receptor. In some embodiments, the anti-E7MC construct is an immunoconjugate. In some embodiments, the anti-E7MC construct binds the E7MC with a Kd between about 0.1 pM to about 500 nM (such as about any of 0.1 pM, 1.0 pM, 10 pM, 50 pM, 100 pM, 500 pM, 1 nM, 10 nM, 50 nM, 100 nM, or 500 nM, including any ranges between these values). In some embodiments, the anti-E7MC construct cross- reacts with at least one (such as at least any of 2, 3, 4, 5, or 6) complex comprising the MHC class I protein and a variant of the HPV16-E7 peptide having one amino acid substitution (such as a conservative amino acid substitution). In some embodiments, the anti-E7MC construct cross-reacts with at least one (such as at least any of 2, 3, 4, or 5) complex comprising the HPV16-E7 peptide and a different subtype of the MHC class I protein.
[0093] In some embodiments, there is provided an anti-E7MC construct comprising an anti- E7MC antibody moiety that specifically binds to a complex comprising an HPV16-E7 11-19 peptide (SEQ ID NO: 4) and HLA-A*02:01. In some embodiments, the anti-E7MC construct is non-naturally occurring. In some embodiments, the anti-E7MC construct is a full-length antibody. In some embodiments, the anti-E7MC construct is a multi- specific (such as bispecific) molecule. In some embodiments, the anti-E7MC construct is a chimeric antigen receptor. In some embodiments, the anti-E7MC construct is an immunoconjugate. In some embodiments, the anti-E7MC construct binds the E7MC with a Kd between about 0.1 pM to about 500 nM (such as about any of 0.1 pM, 1.0 pM, 10 pM, 50 pM, 100 pM, 500 pM, 1 nM,
10 nM, 50 nM, 100 nM, or 500 nM, including any ranges between these values). In some embodiments, the anti-E7MC construct cross-reacts with at least one (such as at least any of 2, 3, 4, 5, or 6) complex comprising the MHC class I protein and a variant of the HPV16-E7 peptide having one amino acid substitution (such as a conservative amino acid substitution). In some embodiments, the anti-E7MC construct cross-reacts with at least one (such as at least any of 2, 3, 4, or 5) complex comprising the HPV16-E7 peptide and a different subtype of the MHC class I protein.
[0094] In some embodiments, there is provided an anti-E7MC construct comprising an anti-
E7MC antibody moiety that specifically binds to a complex comprising an HPV16-E7 peptide and an MHC class I protein, wherein the anti-E7MC antibody moiety comprises: i) a heavy chain variable domain sequence comprising an HC-CDR1 comprising the amino acid sequence of SEQ ID NO: 183, or a variant thereof comprising up to about 3 (for example about any of 1, 2, or 3) amino acid substitutions, an HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 184 or 185, or a variant thereof comprising up to about 3 (for example about any of 1, 2, or 3) amino acid substitutions, and an HC-CDR3 comprising the amino acid sequence of any one of SEQ ID NOs: 186-188; or a variant thereof comprising up to about 3 (for example about any of 1, 2, or 3) amino acid substitutions; and ii) a light chain variable domain comprising an LC-CDR1 comprising the amino acid sequence of SEQ ID
NO: 189 or 190, or a variant thereof comprising up to about 3 (for example about any of 1, 2, or 3) amino acid substitutions, and an LC-CDR3 comprising the amino acid sequence of SEQ
ID NO: 191, or a variant thereof comprising up to about 3 (for example about any of 1, 2, or
3) amino acid substitutions. In some embodiments, the anti-E7MC construct is non-naturally occurring. In some embodiments, the anti-E7MC construct is a full-length antibody. In some embodiments, the anti-E7MC construct is a multi- specific (such as bispecific) molecule. In some embodiments, the anti-E7MC construct is a chimeric antigen receptor. In some embodiments, the anti-E7MC construct is an immunoconjugate. In some embodiments, the anti-E7MC construct binds the E7MC with a Kd between about 0.1 pM to about 500 nM
(such as about any of 0.1 pM, 1.0 pM, 10 pM, 50 pM, 100 pM, 500 pM, 1 nM, 10 nM, 50 nM, 100 nM, or 500 nM, including any ranges between these values). In some embodiments, the anti-E7MC construct cross-reacts with at least one (such as at least any of 2, 3, 4, 5, or 6) complex comprising the MHC class I protein and a variant of the HPV16-E7 peptide having one amino acid substitution (such as a conservative amino acid substitution). In some embodiments, the anti-E7MC construct cross-reacts with at least one (such as at least any of
2, 3, 4, or 5) complex comprising the HPV16-E7 peptide and a different subtype of the MHC class I protein.
[0095] In some embodiments, there is provided an anti-E7MC construct comprising an anti- E7MC antibody moiety that specifically binds to a complex comprising an HPV16-E7 peptide and an MHC class I protein, wherein the anti-E7MC antibody moiety comprises: i) a heavy chain variable domain sequence comprising an HC-CDR1 comprising (and in some embodiments consisting of) the amino acid sequence of any one of SEQ ID NOs: 57-77; or a variant thereof comprising up to about 5 (for example about any of 1, 2, 3, 4, or 5) amino acid substitutions; an HC-CDR2 comprising (and in some embodiments consisting of) the amino acid sequence of any one of SEQ ID NOs: 78-98; or a variant thereof comprising up to about 5 (for example about any of 1, 2, 3, 4, or 5) amino acid substitutions; and an HC-CDR3 comprising (and in some embodiments consisting of) the amino acid sequence of any one of SEQ ID NOs: 99-119, 244, and 245; or a variant thereof comprising up to about 5 (for example about any of 1, 2, 3, 4, or 5) amino acid substitutions; and ii) a light chain variable domain sequence comprising an LC-CDRl comprising (and in some embodiments consisting of) the amino acid sequence of any one of SEQ ID NOs: 120-140 and 246; or a variant thereof comprising up to about 5 (for example about any of 1, 2, 3, 4, or 5) amino acid substitutions; an LC-CDR2 comprising (and in some embodiments consisting of) the amino acid sequence of any one of SEQ ID NOs: 141-161; or a variant thereof comprising up to about 3 (for example about any of 1, 2, or 3) amino acid substitutions; and an LC-CDR3 comprising (and in some embodiments consisting of) the amino acid sequence of any one of SEQ ID NOs: 162-182 and 247-250; or a variant thereof comprising up to about 5 (for example about any of 1, 2, 3, 4, or 5) amino acid substitutions. In some embodiments, the anti-E7MC construct is non-naturally occurring. In some embodiments, the anti-E7MC construct is a full-length antibody. In some embodiments, the anti-E7MC construct is a multi- specific (such as bispecific) molecule. In some embodiments, the anti-E7MC construct is a chimeric antigen receptor. In some embodiments, the anti-E7MC construct is an
immunoconjugate. In some embodiments, the anti-E7MC construct binds the E7MC with a Kd between about 0.1 pM to about 500 nM (such as about any of 0.1 pM, 1.0 pM, 10 pM, 50 pM, 100 pM, 500 pM, 1 nM, 10 nM, 50 nM, 100 nM, or 500 nM, including any ranges between these values). In some embodiments, the anti-E7MC construct cross-reacts with at least one (such as at least any of 2, 3, 4, 5, or 6) complex comprising the MHC class I protein and a variant of the HPV16-E7 peptide having one amino acid substitution (such as a
conservative amino acid substitution). In some embodiments, the anti-E7MC construct cross- reacts with at least one (such as at least any of 2, 3, 4, or 5) complex comprising the HPV16- E7 peptide and a different subtype of the MHC class I protein.
[0096] In some embodiments, there is provided an anti-E7MC construct comprising an anti- E7MC antibody moiety that specifically binds to a complex comprising an HPV16-E7 peptide and an MHC class I protein, wherein the anti-E7MC antibody moiety comprises: i) a heavy chain variable domain sequence comprising an HC-CDR1 comprising (and in some embodiments consisting of) the amino acid sequence of any one of SEQ ID NOs: 57-77; an HC-CDR2 comprising (and in some embodiments consisting of) the amino acid sequence of any one of SEQ ID NOs: 78-98; and an HC-CDR3 comprising (and in some embodiments consisting of) the amino acid sequence of any one of SEQ ID NOs: 99-119, 244, and 245; or a variant thereof comprising up to about 5 (for example about any of 1, 2, 3, 4, or 5) amino acid substitutions in the HC-CDR sequences; and ii) a light chain variable domain sequence comprising an LC-CDR1 comprising (and in some embodiments consisting of) the amino acid sequence of any one of SEQ ID NOs: 120-140 and 246; an LC-CDR2 comprising (and in some embodiments consisting of) the amino acid sequence of any one of SEQ ID NOs: 141-161; and an LC-CDR3 comprising (and in some embodiments consisting of) the amino acid sequence of any one of SEQ ID NOs: 162-182 and 247-250; or a variant thereof comprising up to about 5 (for example about any of 1, 2, 3, 4, or 5) amino acid substitutions in the LC-CDR sequences. In some embodiments, the anti-E7MC construct is non-naturally occurring. In some embodiments, the anti-E7MC construct is a full-length antibody. In some embodiments, the anti-E7MC construct is a multi- specific (such as bispecific) molecule. In some embodiments, the anti-E7MC construct is a chimeric antigen receptor. In some embodiments, the anti-E7MC construct is an immunoconjugate. In some embodiments, the anti-E7MC construct binds the E7MC with a Kd between about 0.1 pM to about 500 nM (such as about any of 0.1 pM, 1.0 pM, 10 pM, 50 pM, 100 pM, 500 pM, 1 nM, 10 nM, 50 nM, 100 nM, or 500 nM, including any ranges between these values). In some embodiments, the anti-E7MC construct cross-reacts with at least one (such as at least any of 2, 3, 4, 5, or 6) complex comprising the MHC class I protein and a variant of the HPV16-E7 peptide having one amino acid substitution (such as a conservative amino acid substitution). In some embodiments, the anti-E7MC construct cross-reacts with at least one (such as at least any of 2, 3, 4, or 5) complex comprising the HPV16-E7 peptide and a different subtype of the MHC class I protein.
[0097] In some embodiments, there is provided an anti-E7MC construct comprising an anti- E7MC antibody moiety that specifically binds to a complex comprising an HPV16-E7 peptide and an MHC class I protein, wherein the anti-E7MC antibody moiety comprises a heavy chain variable domain comprising (and in some embodiments consisting of) the amino acid sequence of any one of SEQ ID NOs: 15-35 and 233-237, or a variant thereof having at least about 95% (for example at least about any of 96%, 97%, 98%, or 99%) sequence identity, and a light chain variable domain comprising (and in some embodiments consisting of) the amino acid sequence of any one of SEQ ID NOs: 36-56 and 238-243, or a variant thereof having at least about 95% (for example at least about any of 96%, 97%, 98%, or 99%) sequence identity. In some embodiments, the anti-E7MC construct is non-naturally occurring. In some embodiments, the anti-E7MC construct is a full-length antibody. In some
embodiments, the anti-E7MC construct is a multi- specific (such as bispecific) molecule. In some embodiments, the anti-E7MC construct is a chimeric antigen receptor. In some embodiments, the anti-E7MC construct is an immunoconjugate. In some embodiments, the anti-E7MC construct binds the E7MC with a Kd between about 0.1 pM to about 500 nM (such as about any of 0.1 pM, 1.0 pM, 10 pM, 50 pM, 100 pM, 500 pM, 1 nM, 10 nM, 50 nM, 100 nM, or 500 nM, including any ranges between these values). In some embodiments, the anti-E7MC construct cross-reacts with at least one (such as at least any of 2, 3, 4, 5, or 6) complex comprising the MHC class I protein and a variant of the HPV16-E7 peptide having one amino acid substitution (such as a conservative amino acid substitution). In some embodiments, the anti-E7MC construct cross-reacts with at least one (such as at least any of 2, 3, 4, or 5) complex comprising the HPV16-E7 peptide and a different subtype of the MHC class I protein.
[0098] In some embodiments, there is provided an anti-E7MC construct comprising a first anti-E7MC antibody moiety that competes for binding to a target HPV16-E7/MHC class I complex with a second anti-E7MC antibody moiety according to any of the anti-E7MC antibody moieties described herein. In some embodiments, the first anti-E7MC antibody moiety binds to the same, or substantially the same, epitope as the second anti-E7MC antibody moiety. In some embodiments, binding of the first anti-E7MC antibody moiety to the target HPV16-E7/MHC class I complex inhibits binding of the second anti-E7MC antibody moiety to the target HPV16-E7/MHC class I complex by at least about 70% (such as by at least about any of 75%, 80%, 85%, 90%, 95%, 98% or 99%), or vice versa. In some embodiments, the first anti-E7MC antibody moiety and the second anti-E7MC antibody
moiety cross-compete for binding to the target HPV16-E7/MHC class I complex, i.e., each of the first and second antibody moieties competes with the other for binding to the target HPV16-E7/MHC class I complex.
[0099] For example, in some embodiments, there is provided an anti-E7MC construct comprising an anti-E7MC antibody moiety that competes for binding to a target HPV16- E7/MHC class I complex with an antibody moiety comprising i) a heavy chain variable domain sequence comprising an HC-CDR1 comprising the amino acid sequence of SEQ ID NO: 183, or a variant thereof comprising up to about 3 (for example about any of 1, 2, or 3) amino acid substitutions, an HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 184 or 185, or a variant thereof comprising up to about 3 (for example about any of 1, 2, or 3) amino acid substitutions, and an HC-CDR3 comprising the amino acid sequence of any one of SEQ ID NOs: 186-188; or a variant thereof comprising up to about 3 (for example about any of 1, 2, or 3) amino acid substitutions; and ii) a light chain variable domain comprising an LC-CDR1 comprising the amino acid sequence of SEQ ID NO: 189 or 190, or a variant thereof comprising up to about 3 (for example about any of 1, 2, or 3) amino acid
substitutions, and an LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 191, or a variant thereof comprising up to about 3 (for example about any of 1, 2, or 3) amino acid substitutions.
[0100] In some embodiments, there is provided an anti-E7MC construct comprising an anti-E7MC antibody moiety that competes for binding to a target HPV16-E7/MHC class I complex with an antibody moiety comprising i) a heavy chain variable domain sequence comprising an HC-CDR1 comprising (and in some embodiments consisting of) the amino acid sequence of any one of SEQ ID NOs: 57-77; or a variant thereof comprising up to about
5 (for example about any of 1, 2, 3, 4, or 5) amino acid substitutions; an HC-CDR2 comprising (and in some embodiments consisting of) the amino acid sequence of any one of
SEQ ID NOs: 78-98; or a variant thereof comprising up to about 5 (for example about any of
1, 2, 3, 4, or 5) amino acid substitutions; and an HC-CDR3 comprising (and in some embodiments consisting of) the amino acid sequence of any one of SEQ ID NOs: 99-119,
244, and 245; or a variant thereof comprising up to about 5 (for example about any of 1, 2, 3,
4, or 5) amino acid substitutions; and ii) a light chain variable domain sequence comprising an LC-CDR1 comprising (and in some embodiments consisting of) the amino acid sequence of any one of SEQ ID NOs: 120-140 and 246; or a variant thereof comprising up to about 5
(for example about any of 1, 2, 3, 4, or 5) amino acid substitutions; an LC-CDR2 comprising
(and in some embodiments consisting of) the amino acid sequence of any one of SEQ ID NOs: 141-161; or a variant thereof comprising up to about 3 (for example about any of 1, 2, or 3) amino acid substitutions; and an LC-CDR3 comprising (and in some embodiments consisting of) the amino acid sequence of any one of SEQ ID NOs: 162-182 and 247-250; or a variant thereof comprising up to about 5 (for example about any of 1, 2, 3, 4, or 5) amino acid substitutions.
[0101] In some embodiments, there is provided an anti-E7MC construct comprising an anti-E7MC antibody moiety that competes for binding to a target HPV16-E7/MHC class I complex with an antibody moiety comprising i) a heavy chain variable domain sequence comprising an HC-CDR1 comprising (and in some embodiments consisting of) the amino acid sequence of any one of SEQ ID NOs: 57-77; an HC-CDR2 comprising (and in some embodiments consisting of) the amino acid sequence of any one of SEQ ID NOs: 78-98; and an HC-CDR3 comprising (and in some embodiments consisting of) the amino acid sequence of any one of SEQ ID NOs: 99-119, 244, and 245; or a variant thereof comprising up to about 5 (for example about any of 1, 2, 3, 4, or 5) amino acid substitutions in the HC-CDR sequences; and ii) a light chain variable domain sequence comprising an LC-CDR1 comprising (and in some embodiments consisting of) the amino acid sequence of any one of SEQ ID NOs: 120-140 and 246; an LC-CDR2 comprising (and in some embodiments consisting of) the amino acid sequence of any one of SEQ ID NOs: 141-161; and an LC- CDR3 comprising (and in some embodiments consisting of) the amino acid sequence of any one of SEQ ID NOs: 162-182 and 247-250; or a variant thereof comprising up to about 5 (for example about any of 1, 2, 3, 4, or 5) amino acid substitutions in the LC-CDR sequences.
[0102] In some embodiments, there is provided an anti-E7MC construct comprising an anti-E7MC antibody moiety that competes for binding to a target HPV16-E7/MHC class I complex with an antibody moiety comprising a heavy chain variable domain comprising (and in some embodiments consisting of) the amino acid sequence of any one of SEQ ID NOs: 15- 35 and 233-237, or a variant thereof having at least about 95% (for example at least about any of 96%, 97%, 98%, or 99%) sequence identity, and a light chain variable domain comprising (and in some embodiments consisting of) the amino acid sequence of any one of SEQ ID NOs: 36-56 and 238-243, or a variant thereof having at least about 95% (for example at least about any of 96%, 97%, 98%, or 99%) sequence identity.
[0103] The different aspects are discussed in various sections below in further detail.
Anti-E7MC antibody moiety
[0104] The anti-E7MC constructs comprise an anti-E7MC antibody moiety that specifically binds to a complex comprising an HPV16-E7 peptide and an MHC class I protein.
[0105] In some embodiments, the anti-E7MC antibody moiety specifically binds to an E7MC present on the surface of a cell. In some embodiments, the cell is a cancer cell. In some embodiments, the cancer cell is in a solid tumor. In some embodiments, the cancer cell is a metastatic cancer cell.
[0106] In some embodiments, the HPV16-E7 peptide is an MHC class I-restricted peptide. In some embodiments, the HPV16-E7 peptide is from about 8 to about 12 (such as about any of 8, 9, 10, 11, or 12) amino acids in length.
[0107] In some embodiments, the HPV16-E7 peptide comprises (and in some embodiments consists of) the sequence of amino acids 7-15 of HPV16-E7 (TLHEYMLDL, SEQ ID NO: 3), amino acids 11-19 of HPV16-E7 (YMLDLQPET, SEQ ID NO: 4, also referred to herein as "HPV16-E7 11-19"), amino acids 16-25 of HPV16-E7 (QPETTDLYCY, SEQ ID NO: 5), amino acids 44-52 of HPV16-E7 (QAEPDRAHY, SEQ ID NO: 6), amino acids 46-55 of HPV16-E7 (EPDRAHYNIV, SEQ ID NO: 7), amino acids 49-57 of HPV16-E7
(RAHYNIVTF, SEQ ID NO: 8), amino acids 82-90 of HPV16-E7 (LLMGTLGIV, SEQ ID NO: 9), or amino acids 86-93 of HPV16-E7 (TLGIVCPI, SEQ ID NO: 10).
[0108] In some embodiments, the MHC class I protein is HLA-A, HLA-B, HLA-C, HLA- E, HLA-F, or HLA-G. In some embodiments, the MHC class I protein is HLA-A. In some embodiments, the HLA-A is HLA-A02. In some embodiments, the HLA-A02 is HLA- A*02:01.
[0109] In some embodiments, the anti-E7MC antibody moiety is a full-length antibody. In some embodiments, the anti-E7MC antibody moiety is an antigen-binding fragment, for example an antigen-binding fragment selected from the group consisting of a Fab, a Fab', a F(ab')2, an Fv fragment, a disulfide stabilized Fv fragment (dsFv), and a single-chain antibody molecule (scFv). In some embodiments, the anti-E7MC antibody moiety is an scFv. In some embodiments, the anti-E7MC antibody moiety is human, humanized, or semisynthetic.
[0110] In some embodiments, the anti-E7MC antibody moiety specifically binds to the N- terminal portion of the HPV16-E7 peptide in the complex. In some embodiments, the anti-
E7MC antibody moiety specifically binds to the C-terminal portion of the HPV16-E7 peptide
in the complex. In some embodiments, the anti-E7MC antibody moiety specifically binds to the middle portion of the HPV16-E7 peptide in the complex.
[0111] In some embodiments, the anti-E7MC antibody moiety (or the anti-E7MC construct comprising the anti-E7MC antibody moiety) binds to the complex comprising the HPV16-E7 peptide and the MHC class I protein with an affinity that is at least about 10 (including for example at least about any of 10, 20, 30, 40, 50, 75, 100, 200, 300, 400, 500, 750, 1000 or more) times its binding affinity for each of full-length HPV16-E7, free HPV16-E7 peptide, MHC class I protein not bound to a peptide, and MHC class I protein bound to a non-HPV16- E7 peptide. In some embodiments, the anti-E7MC antibody moiety (or the anti-E7MC construct comprising the anti-E7MC antibody moiety) binds to the complex comprising the HPV16-E7 peptide and the MHC class I protein with a Kd no more than about 1/10 (such as no more than about any of 1/10, 1/20, 1/30, 1/40, 1/50, 1/75, 1/100, 1/200, 1/300, 1/400, 1/500, 1/750, 1/1000 or less) times its Kd for binding to each of full-length HPV16-E7, free HPV16-E7 peptide, MHC class I protein not bound to a peptide, and MHC class I protein bound to a non-HPV16-E7 peptide.
[0112] In some embodiments, the anti-E7MC antibody moiety (or the anti-E7MC construct comprising the anti-E7MC antibody moiety) binds to the complex comprising the HPV16-E7 peptide and the MHC class I protein with a Kd between about 0.1 pM to about 500 nM (such as about any of 0.1 pM, 1.0 pM, 10 pM, 50 pM, 100 pM, 500 pM, 1 nM, 10 nM, 50 nM, 100 nM, or 500 nM, including any ranges between these values). In some embodiments, the anti-
E7MC antibody moiety (or the anti-E7MC construct comprising the anti-E7MC antibody moiety) binds to the complex comprising the HPV16-E7 peptide and the MHC class I protein with a Kd between about 1 pM to about 250 pM (such as about any of 1, 10, 25, 50, 75, 100,
150, 200, or 250 pM, including any ranges between these values). In some embodiments, the anti-E7MC antibody moiety (or the anti-E7MC construct comprising the anti-E7MC antibody moiety) binds to the complex comprising the HPV16-E7 peptide and the MHC class I protein with a Kd between about 1 nM to about 500 nM (such as about any of 1, 10, 25, 50, 75, 100,
150, 200, 250, 300, 350, 400, 450, or 500 nM, including any ranges between these values).
[0113] In some embodiments, the anti-E7MC antibody moiety specifically binds to a complex comprising an HPV16-E7 peptide and an MHC class I protein, wherein the anti-
E7MC antibody moiety cross-reacts with at least one complex comprising the HPV16-E7 peptide and an allelic variant of the MHC class I protein. In some embodiments, the allelic variant has up to about 10 (such as about any of 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10) amino acid
substitutions when compared to the MHC class I protein. In some embodiments, the allelic variant is the same serotype as the MHC class I protein. In some embodiments, the allelic variant is a different serotype than the MHC class I protein. In some embodiments, the anti- E7MC antibody moiety does not cross-react with any complex comprising the HPV16-E7 peptide and an allelic variant of the MHC class I protein. In some embodiments, the anti- E7MC antibody moiety cross-reacts with at least one (such as at least any of 2, 3, 4, or 5) complex comprising the HPV16-E7 peptide and a different subtype of the MHC class I protein.
[0114] In some embodiments, the anti-E7MC antibody moiety specifically binds to a complex comprising an HPV16-E7 peptide and an MHC class I protein, wherein the anti- E7MC antibody moiety cross-reacts with at least one complex comprising the MHC class I protein and a variant of the HPV16-E7 peptide having one amino acid substitution (such as a conservative amino acid substitution). In some embodiments, the anti-E7MC antibody moiety does not cross-react with any complex comprising the MHC class I protein and a variant of the HPV16-E7 peptide.
[0115] For example, in some embodiments, the anti-E7MC antibody moiety specifically binds to a complex comprising HPV16-E7 11-19 (SEQ ID NO: 4) and an MHC class I protein (such as HLA-A02, for example HLA-A*02:01). In some embodiments, the anti- E7MC antibody moiety further binds to at least one (including at least about any of 2 or 3) of: a complex comprising an alanine-substituted HPV16-E7 peptide of SEQ ID NO: 12 and an MHC class I protein (such as HLA-A02, for example HLA-A*02:01); a complex comprising an alanine-substituted HPV16-E7 peptide of SEQ ID NO: 13 and an MHC class I protein (such as HLA-A02, for example HLA-A*02:01); and a complex comprising an alanine- substituted HPV16-E7 peptide of SEQ ID NO: 14 and an MHC class I protein (such as HLA- A02, for example HLA-A*02:01).
[0116] In some embodiments, the anti-E7MC antibody moiety specifically binds to: a complex comprising an HPV16-E7 peptide of SEQ ID NO: 4 and an MHC class I protein (such as HLA-A02, for example HLA-A*02:01); a complex comprising an alanine- substituted HPV16-E7 peptide of SEQ ID NO: 12 and an MHC class I protein (such as HLA- A02, for example HLA-A*02:01); and a complex comprising an alanine-substituted HPV16- E7 peptide of SEQ ID NO: 13 and an MHC class I protein (such as HLA-A02, for example HLA-A*02:01).
[0117] In some embodiments, the anti-E7MC antibody moiety specifically binds to: a complex comprising an HPV16-E7 peptide of SEQ ID NO: 4 and an MHC class I protein (such as HLA-A02, for example HLA-A*02:01); a complex comprising an alanine- substituted HPV16-E7 peptide of SEQ ID NO: 12 and an MHC class I protein (such as HLA- A02, for example HLA-A*02:01); and a complex comprising an alanine-substituted HPV16- E7 peptide of SEQ ID NO: 14 and an MHC class I protein (such as HLA-A02, for example HLA-A*02:01).
[0118] In some embodiments, the anti-E7MC antibody moiety specifically binds to: a complex comprising an HPV16-E7 peptide of SEQ ID NO: 4 and an MHC class I protein (such as HLA-A02, for example HLA-A*02:01); and a complex comprising an alanine- substituted HPV16-E7 peptide of SEQ ID NO: 12 and an MHC class I protein (such as HLA- A02, for example HLA-A*02:01).
[0119] In some embodiments, the anti-E7MC antibody moiety specifically binds to: a complex comprising an HPV16-E7 peptide of SEQ ID NO: 4 and an MHC class I protein (such as HLA-A02, for example HLA-A*02:01); and a complex comprising an alanine- substituted HPV16-E7 peptide of SEQ ID NO: 14 and an MHC class I protein (such as HLA- A02, for example HLA-A*02:01).
[0120] In some embodiments, the anti-E7MC antibody moiety specifically binds to a complex comprising HPV16-E7 11-19 (SEQ ID NO: 4) and HLA-A*02:01. In some embodiments, the anti-E7MC antibody moiety cross-reacts with at least one (including at least about any of 2, 3, 4, 5, or 6) of: a complex comprising HPV16-E7 11-19 (SEQ ID NO: 4) and HLA-A*02:02 (GenBank Accession No.: AFL91480), a complex comprising HPV16- E7 11-19 (SEQ ID NO: 4) and HLA-A*02:03 (GenBank Accession No.: AAA03604), a complex comprising HPV16-E7 11-19 (SEQ ID NO: 4) and HLA-A*02:05 (GenBank Accession No.: AAA03603), a complex comprising HPV16-E7 11-19 (SEQ ID NO: 4) and HLA-A*02:06 (GenBank Accession No.: CCB78868), a complex comprising HPV16-E7 11- 19 (SEQ ID NO: 4) and HLA-A*02:07 (GenBank Accession No.: ACR55712), and a complex comprising HPV16-E7 11-19 (SEQ ID NO: 4) and HLA-A*02: 11 (GenBank Accession No.: CAB56609).
[0121] In some embodiments, the anti-E7MC antibody moiety specifically binds to: a complex comprising HPV16-E7 11-19 (SEQ ID NO: 4) and an MHC class I protein (such as HLA-A02, for example HLA-A*02:01); and a complex comprising an HPV16-E7 11-19
variant having the amino acid sequence of YMLDVQPET (SEQ ID NO: 11) and an MHC class I protein (such as HLA-A02, for example HLA-A*02:01).
[0122] In some embodiments, the anti-E7MC antibody moiety is a semi-synthetic antibody moiety comprising fully human sequences and one or more synthetic regions. In some embodiments, the anti-E7MC antibody moiety is a semi-synthetic antibody moiety comprising a fully human light chain variable domain and a semi-synthetic heavy chain variable domain comprising fully human FR1, HC-CDR1, FR2, HC-CDR2, FR3, and FR4 regions and a synthetic HC-CDR3. In some embodiments, the semi- synthetic heavy chain variable domain comprises a fully synthetic HC-CDR3 having a sequence from about 5 to about 25 (such as about any of 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, or 25) amino acids in length. In some embodiments, the semi-synthetic heavy chain variable domain or the synthetic HC-CDR3 is obtained from a semi-synthetic library (such as a semi-synthetic human library) comprising fully synthetic HC-CDR3s having a sequence from about 5 to about 25 (such as about any of 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, or 25) amino acids in length, wherein each amino acid in the sequence is randomly selected from the standard human amino acids, minus cysteine. In some embodiments, the synthetic HC-CDR3 is from about 7 to about 15 (such as about any of 7, 8, 9, 10, 11, 12, 13, 14, or 15) amino acids in length.
[0123] The anti-E7MC antibody moieties in some embodiments comprise specific sequences or certain variants of such sequences. In some embodiments, the amino acid substitutions in the variant sequences do not substantially reduce the ability of the anti-E7MC antibody moiety to bind the E7MC. For example, alterations that do not substantially reduce E7MC binding affinity may be made. Alterations that substantially improve E7MC binding affinity or affect some other property, such as specificity and/or cross -reactivity with related variants of the E7MC, are also contemplated.
[0124] In some embodiments, the anti-E7MC antibody moiety comprises i) a heavy chain variable domain comprising an HC-CDR3 comprising the amino acid sequence of any one of
SEQ ID NOs: 186-188, or a variant thereof comprising up to about 3 (for example about any of 1, 2, or 3) amino acid substitutions; and ii) a light chain variable domain comprising an
LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 191, or a variant thereof comprising up to about 3 (for example about any of 1, 2, or 3) amino acid substitutions.
[0125] In some embodiments, the anti-E7MC antibody moiety comprises i) a heavy chain variable domain comprising an HC-CDR3 comprising the amino acid sequence of any one of
SEQ ID NOs: 186-188; and ii) a light chain variable domain comprising an LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 191.
[0126] In some embodiments, the anti-E7MC antibody moiety comprises i) a heavy chain variable domain comprising an HC-CDR1 comprising the amino acid sequence of SEQ ID NO: 183, or a variant thereof comprising up to about 3 (for example about any of 1, 2, or 3) amino acid substitutions, an HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 184 or 185, or a variant thereof comprising up to about 3 (for example about any of 1, 2, or 3) amino acid substitutions, and an HC-CDR3 comprising the amino acid sequence of any one of SEQ ID NOs: 186-188, or a variant thereof comprising up to about 3 (for example about any of 1, 2, or 3) amino acid substitutions; and ii) a light chain variable domain comprising an LC-CDRl comprising the amino acid sequence of SEQ ID NO: 189 or 190, or a variant thereof comprising up to about 3 (for example about any of 1, 2, or 3) amino acid
substitutions, and an LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 191, or a variant thereof comprising up to about 3 (for example about any of 1, 2, or 3) amino acid substitutions.
[0127] In some embodiments, the anti-E7MC antibody moiety comprises i) a heavy chain variable domain comprising an HC-CDR1 comprising the amino acid sequence of SEQ ID
NO: 183, or a variant thereof comprising up to about 3 (for example about any of 1, 2, or 3) amino acid substitutions, an HC-CDR2 comprising the amino acid sequence of SEQ ID NO:
184 or 185, or a variant thereof comprising up to about 3 (for example about any of 1, 2, or 3) amino acid substitutions, and an HC-CDR3 comprising the amino acid sequence of any one of SEQ ID NOs: 186-188; and ii) a light chain variable domain comprising an LC-CDRl comprising the amino acid sequence of SEQ ID NO: 189 or 190, or a variant thereof comprising up to about 3 (for example about any of 1, 2, or 3) amino acid substitutions, and an LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 191.
[0128] In some embodiments, the anti-E7MC antibody moiety comprises i) a heavy chain variable domain comprising an HC-CDR1 comprising the amino acid sequence of SEQ ID
NO: 183, an HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 184 or 185, and an HC-CDR3 comprising the amino acid sequence of any one of SEQ ID NOs: 186-188; or a variant thereof comprising up to about 3 (such as about any of 1, 2, or 3) amino acid substitutions in the HC-CDR sequences; and ii) a light chain variable domain comprising an
LC-CDRl comprising the amino acid sequence of SEQ ID NO: 189 or 190, and an LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 191; or a variant thereof comprising up
to about 3 (such as about any of 1, 2, or 3) amino acid substitutions in the LC-CDR sequences.
[0129] In some embodiments, the anti-E7MC antibody moiety comprises i) a heavy chain variable domain comprising an HC-CDR1 comprising the amino acid sequence of SEQ ID NO: 183, an HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 184 or 185, and an HC-CDR3 comprising the amino acid sequence of any one of SEQ ID NOs: 186-188; and ii) a light chain variable domain comprising an LC-CDR 1 comprising the amino acid sequence of SEQ ID NO: 189 or 190, and an LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 191. The sequences of the CDRs noted herein are provided in Table 2 below.
TABLE 2
[0130] In some embodiments, the anti-E7MC antibody moiety comprises i) a heavy chain variable domain comprising an HC-CDR3 comprising the amino acid sequence of any one of SEQ ID NOs: 99-119, 244, and 245, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions; and ii) a light chain variable domain comprising an LC-CDR3 comprising the amino acid sequence of any one of SEQ ID NOs: 162-182 and 247-250, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions.
[0131] In some embodiments, the anti-E7MC antibody moiety comprises i) a heavy chain variable domain comprising an HC-CDR3 comprising the amino acid sequence of any one of SEQ ID NOs: 99-119, 244, and 245; and ii) a light chain variable domain comprising an LC- CDR3 comprising the amino acid sequence of any one of SEQ ID NOs: 162-182 and 247- 250.
[0132] In some embodiments, the anti-E7MC antibody moiety comprises i) a heavy chain variable domain comprising an HC-CDRl comprising the amino acid sequence of any one of SEQ ID NOs: 57-77, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions, an HC-CDR2 comprising the amino acid sequence of any one of SEQ ID NOs: 78-98, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions, and an HC-CDR3 comprising the amino acid sequence of any one of SEQ ID NOs: 99-119, 244, and 245, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions; and ii) a light chain variable domain comprising an LC-CDR1 comprising the amino acid sequence of any one of SEQ ID NOs: 120-140 and 246, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions, an LC-CDR2 comprising the amino acid sequence of any one of SEQ ID NOs: 141-161, or a variant thereof comprising up to about 3 (such as about any of 1, 2, or 3) amino acid substitutions, and an LC-CDR3 comprising the amino acid sequence of any one of SEQ ID NOs: 162-182 and 247-250, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions.
[0133] In some embodiments, the anti-E7MC antibody moiety comprises i) a heavy chain variable domain comprising an HC-CDRl comprising the amino acid sequence of any one of SEQ ID NOs: 57-77, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions, an HC-CDR2 comprising the amino acid sequence of any one of SEQ ID NOs: 78-98, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions, and an HC-CDR3 comprising the amino acid sequence of any one of SEQ ID NOs: 99-119, 244, and 245; and ii) a light chain variable domain comprising an LC-CDR1 comprising the amino acid sequence of any one of SEQ ID NOs: 120-140 and 246, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions, an LC-CDR2 comprising the amino acid sequence of any one of SEQ ID NOs: 141-161, or a variant thereof comprising up to about 3 (such as
about any of 1, 2, or 3) amino acid substitutions, and an LC-CDR3 comprising the amino acid sequence of any one of SEQ ID NOs: 162-182 and 247-250.
[0134] In some embodiments, the anti-E7MC antibody moiety comprises i) a heavy chain variable domain sequence comprising an HC-CDR 1 comprising the amino acid sequence of any one of SEQ ID NOs: 57-77; an HC-CDR2 comprising the amino acid sequence of any one of SEQ ID NOs: 78-98; and an HC-CDR3 comprising the amino acid sequence of any one of SEQ ID NOs: 99-119, 244, and 245; or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions in the HC-CDR sequences; and ii) a light chain variable domain sequence comprising an LC-CDR1 comprising the amino acid sequence of any one of SEQ ID NOs: 120-140 and 246; an LC-CDR2 comprising the amino acid sequence of any one of SEQ ID NOs: 141-161; and an LC-CDR3 comprising the amino acid sequence of any one of SEQ ID NOs: 162-182 and 247-250; or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions in the LC-CDR sequences.
[0135] In some embodiments, the anti-E7MC antibody moiety comprises i) a heavy chain variable domain sequence comprising an HC-CDR 1 comprising the amino acid sequence of any one of SEQ ID NOs: 57-77; an HC-CDR2 comprising the amino acid sequence of any one of SEQ ID NOs: 78-98; and an HC-CDR3 comprising the amino acid sequence of any one of SEQ ID NOs: 99-119, 244, and 245; or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions, wherein the amino acid substitutions are in HC-CDR1 or HC-CDR2; and ii) a light chain variable domain sequence comprising an LC-CDR 1 comprising the amino acid sequence of any one of SEQ ID NOs: 120-140 and 246; an LC-CDR2 comprising the amino acid sequence of any one of SEQ ID NOs: 141-161; and an LC-CDR3 comprising the amino acid sequence of any one of SEQ ID NOs: 162-182 and 247-250; or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions, wherein the amino acid substitutions are in HC- CDR 1 or HC-CDR2.
[0136] In some embodiments, the anti-E7MC antibody moiety comprises i) a heavy chain variable domain sequence comprising an HC-CDR 1 comprising the amino acid sequence of any one of SEQ ID NOs: 57-77; an HC-CDR2 comprising the amino acid sequence of any one of SEQ ID NOs: 78-98; and an HC-CDR3 comprising the amino acid sequence of any one of SEQ ID NOs: 99-119, 244, and 245; and ii) a light chain variable domain sequence comprising an LC-CDR 1 comprising the amino acid sequence of any one of SEQ ID NOs:
120-140 and 246; an LC-CDR2 comprising the amino acid sequence of any one of SEQ ID NOs: 141-161; and an LC-CDR3 comprising the amino acid sequence of any one of SEQ ID NOs: 162-182 and 247-250. The sequences of the HC-CDRs noted herein are provided in Table 3 below and the LC-CDRs noted herein are provided in Table 4 below.
TABLE 3
SEQ ID NO: 57 SEQ ID NO: 78 SEQ ID NO: 99
HC-CD 11 GYTFIDYY HC-CDR21 INPKSGGT HC-CDR31 ARSYYYGGVKDY
SEQ ID NO: 58 SEQ ID NO: 79 SEQ ID NO: 100
HC-CDR12 GGTFSSYA HC-CDR22 IIPIFGTA HC-CDR32 ARGVYGYSGSAPYDE
SEQ ID NO: 59 SEQ ID NO: 80 SEQ ID NO: 101
HC-CDR13 GGTFSMAA HC-CDR23 IIPMIGIP HC-CDR33 ARGPLYWWHSDS
SEQ ID NO: 60 SEQ ID NO: 81 SEQ ID NO: 102
HC-CDR14 GFTFSSYA HC-CDR24 ISYDGTNK HC-CDR34 ARMHGSYGSYFDK
SEQ ID NO: 61 SEQ ID NO: 82 SEQ ID NO: 103
HC-CDR15 GGTFRSYA HC-CDR25 IIPIFGTP HC-CDR35 ARSSMYQYSHDD
SEQ ID NO: 62 SEQ ID NO: 83 SEQ ID NO: 104
HC-CDR18 GYTFANYG HC-CDR28 ISASNGNT HC-CDR38 ARSYYAGYYMFMDF
SEQ ID NO: 63 SEQ ID NO: 84 SEQ ID NO: 105
HC-CDR19 GFTFSSYW HC-CDR29 INQDGSEK HC-CDR39 ARYSVWGMMDE
SEQ ID NO: 64 SEQ ID NO: 85 SEQ ID NO: 106
HC-CDR110 GFPFSSYS HC-CDR210 ISSSSSTI HC-CDR310 ARQNYYADYDY
SEQ ID NO: 65 SEQ ID NO: 86 SEQ ID NO: 107
HC-CDR111 GYTFSDYG HC-CDR211 ISTYNGNT HC-CDR311 ARGYTGSYYATGDE
SEQ ID NO: 66 SEQ ID NO: 87 SEQ ID NO: 108
HC-CDR113 GYTFTSYG HC-CDR213 ISPYNGNT HC-CDR313 ARGYKDY
SEQ ID NO: 67 SEQ ID NO: 88 SEQ ID NO: 109
HC-CDR117 GDIFRKFA HC-CDR217 IIPNLDIT HC-CDR317 ARGSIYQWSGWDS
SEQ ID NO: 68 SEQ ID NO: 89 SEQ ID NO: 110
HC-CDR122 GFNFSDYY HC-CDR222 ISPGGTT HC-CDR322 ARGHSFSYGEDY
SEQ ID NO: 69 SEQ ID NO: 90 SEQ ID NO: 111
HC-CDR126 GYTFTGYY HC-CDR226 INPNSGGT HC-CDR326 ARGWHQYGIMDY
SEQ ID NO: 70 SEQ ID NO: 91 SEQ ID NO: 112
HC-CDR127 GFTFSSYA HC-CDR227 ISGSGGST HC-CDR327 ARRSVWSAYDS
SEQ ID NO: 71 SEQ ID NO: 92 SEQ ID NO: 113
HC-CDR131 GFTFSSYW HC-CDR231 IKEDGSVK HC-CDR331 ARRGVWGHIDF
SEQ ID NO: 72 SEQ ID NO: 93 SEQ ID NO: 114
HC-CDR132 GGTFSSYA HC-CDR232 IIPILGIA HC-CDR332 ARGTYTWGSDT
SEQ ID NO: 73 SEQ ID NO: 94 SEQ ID NO: 115
HC-CDR139 GFSFSRHA HC-CDR239 ISGSGGNT HC-CDR339 ARYWGSYDK
SEQ ID NO: 74 SEQ ID NO: 95 SEQ ID NO: 116
HC-CDR140 GYSFSDYY HC-CDR240 INPNTGVT HC-CDR340 ARNVYRYSMMHDS
SEQ ID NO: 75 SEQ ID NO: 96 SEQ ID NO: 117
HC-CDR141 GFTFSSYS HC-CDR241 ISSSSSYI HC-CDR341 ARRGVWGYFDS
SEQ ID NO: 76 SEQ ID NO: 97 SEQ ID NO: 118
HC-CDR1 US-5 GGTFSSYG HC-CDR2 US-5 IIPIFGTT HC-CDR3 US-5 ARVYGSYFYDD
SEQID NO: 77 SEQID NO: 98 SEQID NO: 119
HC-CDR1 US-7 GGSFSGYY HC-CDR2 US-7 INHSGST HC-CDR3 US-7 ARAPQSWYVGDV
TABLE 4
SEQID NO: SEQID NO:
120 141 SEQID NO: 162
LC-CDR11 SSNIGTNP LC-CDR21 GNY LC-CDR31 AAWDDSLTGYV
SEQID NO: SEQID NO:
121 142 SEQID NO: 163
LC-CDR12 NIGMKS LC-CDR22 YDS LC-CDR32 QVWDTTGDHPGYV
SEQID NO: SEQID NO:
122 143 SEQID NO: 164
LC-CDR13 SSNIGNNY LC-CDR23 DNY LC-CDR33 GTWDSSLSAYV
SEQID NO: SEQID NO:
123 144 SEQID NO: 165
LC-CDR14 NIGSKS LC-CDR24 YNS LC-CDR34 QVWDSSSDHWV
SEQID NO: SEQID NO:
124 145 SEQID NO: 166
LC-CDR15 QGISSW LC-CDR25 AAS LC-CDR35 QQANSFPLT
SEQID NO: SEQID NO:
125 146 SEQID NO: 167
LC-CDR18 NSNIETNP LC-CDR28 SYY LC-CDR38 ASWDDSVQGYV
SEQID NO: SEQID NO:
126 147 SEQID NO: 168
LC-CDR19 SLRSYY LC-CDR29 GKN LC-CDR39 NSRDSSGNHQV
SEQID NO: SEQID NO:
127 148 SEQID NO: 169
LC-CDR110 NIGSKN LC-CDR210 DDH LC-CDR310 QVWDSSSDHVV
SEQID NO: SEQID NO:
128 149 SEQID NO: 170
LC-CDR111 SSNIGINT LC-CDR211 GNS LC-CDR311 QSYDTSLTVI
SEQID NO: SEQID NO:
129 150 SEQID NO: 171
LC-CDR113 TGAVTSGYY LC-CDR213 STN LC-CDR313 LLYYGGAQLWV
SEQID NO: SEQID NO:
130 151 SEQID NO: 172
LC-CDR117 QSISSY LC-CDR217 GAS LC-CDR317 QQSYSAPLT
SEQID NO: SEQID NO:
131 152 SEQID NO: 173
LC-CDR122 SSNIGSNS LC-CDR222 SNN LC-CDR322 AAWDDSLNGYV
SEQID NO: SEQID NO:
132 153 SEQID NO: 174
LC-CDR126 SSNIGAGYD LC-CDR226 ESN LC-CDR326 QSYDTSLKGV
SEQID NO: SEQID NO:
133 154 SEQID NO: 175
LC-CDR127 ILRNYY LC-CDR227 GQN LC-CDR327 DSRDSSGNHWV
SEQID NO: SEQID NO: SEQID NO: 176
134 NLRNSY 155 GKN LC-CDR331 NSRDSSGFPPYV
LC-CD 1 31 LC-CDR2 31
SEQ ID NO: SEQ ID NO:
135 156 SEQ ID NO: 177
LC-CDR1 32 KLGEKY LC-CDR2 32 QND LC-CDR3 32 QSWASSSVYV
SEQ ID NO: SEQ ID NO:
136 157 SEQ ID NO: 178
LC-CDR1 39 SLRNYY LC-CDR2 39 GKD LC-CDR3 39 NSRDSSGNHRV
SEQ ID NO: SEQ ID NO:
137 158 SEQ ID NO: 179
LC-CDR1 40 SSNIGSNH LC-CDR2 40 NNN LC-CDR3 40 AAWDDSLNVPV
SEQ ID NO: SEQ ID NO:
138 159 SEQ ID NO: 180
LC-CDR1 41 TLRSFY LC-CDR2 41 GKN LC-CDR3 41 NSRDSGGDPVV
SEQ ID NO: SEQ ID NO:
139 160 SEQ ID NO: 181
LC-CDR1 US-5 TGAVTSSYY LC-CDR2 US-5 STS LC-CDR3 US-5 LLYYGGARV
SEQ ID NO: SEQ ID NO:
140 161 SEQ ID NO: 182
LC-CDR1 US-7 SSNIGTRM LC-CDR2 US-7 NNN LC-CDR3 US-7 AAWDDNLKSYV
[0137] In some embodiments, the anti-E7MC antibody moiety comprises a heavy chain variable domain comprising the amino acid sequence of any one of SEQ ID NOs: 15-35 and 233-237, or a variant thereof having at least about 95% (including for example at least about any of 96%, 97%, 98%, or 99%) sequence identity, and a light chain variable domain comprising the amino acid sequence of any one of SEQ ID NOs: 36-56 and 238-243, or a variant thereof having at least about 95% (including for example at least any of 96%, 97%, 98%, or 99%) sequence identity.
[0138] In some embodiments, the anti-E7MC antibody moiety comprises a heavy chain variable domain comprising the amino acid sequence of any one of SEQ ID NOs: 15-35 and 233-237 and a light chain variable domain comprising the amino acid sequence of any one of SEQ ID NOs: 36-56 and 238-243.
[0139] The heavy and light chain variable domains can be combined in various pair- wise combinations to generate a number of anti-E7MC antibody moieties.
[0140] For example, in some embodiments, the anti-E7MC antibody moiety comprises a heavy chain variable domain comprising an HC-CDR1 comprising the amino acid sequence of SEQ ID NO: 57, or a variant thereof comprising up to about 5 (for example about any of 1,
2, 3, 4, or 5) amino acid substitutions; an HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 78, or a variant thereof comprising up to about 5 (for example about any of 1, 2,
3, 4, or 5) amino acid substitutions; and an HC-CDR3 comprising the amino acid sequence of
SEQ ID NO: 99, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions; and a light chain variable domain comprising an LC-CDR1 comprising the amino acid sequence of SEQ ID NO: 120, or a variant thereof comprising up to about 5 (for example about any of 1, 2, 3, 4, or 5) amino acid substitutions; an LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 141, or a variant thereof comprising up to about 3 (for example about any of 1, 2, or 3) amino acid substitutions; and an LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 162, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions.
[0141] In some embodiments, the anti-E7MC antibody moiety comprises a heavy chain variable domain comprising an HC-CDR1 comprising the amino acid sequence of SEQ ID NO: 57, an HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 78, and an HC- CDR3 comprising the amino acid sequence of SEQ ID NO: 99, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions in the HC-CDR sequences; and a light chain variable domain comprising an LC-CDR1 comprising the amino acid sequence of SEQ ID NO: 120, an LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 141, and an LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 162, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions in the LC-CDR sequences.
[0142] In some embodiments, the anti-E7MC antibody moiety comprises a heavy chain variable domain comprising an HC-CDR 1 comprising the amino acid sequence of SEQ ID NO: 57, an HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 78, and an HC- CDR3 comprising the amino acid sequence of SEQ ID NO: 99; and a light chain variable domain comprising an LC-CDR1 comprising the amino acid sequence of SEQ ID NO: 120, an LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 141, and an LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 162.
[0143] In some embodiments, the anti-E7MC antibody moiety comprises a heavy chain variable domain comprising an HC-CDR 1 comprising the amino acid sequence of SEQ ID
NO: 58, or a variant thereof comprising up to about 5 (for example about any of 1, 2, 3, 4, or
5) amino acid substitutions; an HC-CDR2 comprising the amino acid sequence of SEQ ID
NO: 79, or a variant thereof comprising up to about 5 (for example about any of 1, 2, 3, 4, or
5) amino acid substitutions; and an HC-CDR3 comprising the amino acid sequence of SEQ
ID NO: 100, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or
5) amino acid substitutions; and a light chain variable domain comprising an LC-CDR1
comprising the amino acid sequence of SEQ ID NO: 121, or a variant thereof comprising up to about 5 (for example about any of 1, 2, 3, 4, or 5) amino acid substitutions; an LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 142, or a variant thereof comprising up to about 3 (for example about any of 1, 2, or 3) amino acid substitutions; and an LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 163, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions.
[0144] In some embodiments, the anti-E7MC antibody moiety comprises a heavy chain variable domain comprising an HC-CDR 1 comprising the amino acid sequence of SEQ ID NO: 58, an HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 79, and an HC- CDR3 comprising the amino acid sequence of SEQ ID NO: 100, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions in the HC-CDR sequences; and a light chain variable domain comprising an LC-CDRl comprising the amino acid sequence of SEQ ID NO: 121, an LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 142, and an LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 163, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions in the LC-CDR sequences.
[0145] In some embodiments, the anti-E7MC antibody moiety comprises a heavy chain variable domain comprising an HC-CDR 1 comprising the amino acid sequence of SEQ ID NO: 58, an HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 79, and an HC- CDR3 comprising the amino acid sequence of SEQ ID NO: 100; and a light chain variable domain comprising an LC-CDRl comprising the amino acid sequence of SEQ ID NO: 121, an LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 142, and an LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 163.
[0146] In some embodiments, the anti-E7MC antibody moiety comprises a heavy chain variable domain comprising an HC-CDR 1 comprising the amino acid sequence of SEQ ID
NO: 59, or a variant thereof comprising up to about 5 (for example about any of 1, 2, 3, 4, or
5) amino acid substitutions; an HC-CDR2 comprising the amino acid sequence of SEQ ID
NO: 80, or a variant thereof comprising up to about 5 (for example about any of 1, 2, 3, 4, or
5) amino acid substitutions; and an HC-CDR3 comprising the amino acid sequence of SEQ
ID NO: 101, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or
5) amino acid substitutions; and a light chain variable domain comprising an LC-CDRl comprising the amino acid sequence of SEQ ID NO: 122, or a variant thereof comprising up to about 5 (for example about any of 1, 2, 3, 4, or 5) amino acid substitutions; an LC-CDR2
comprising the amino acid sequence of SEQ ID NO: 143, or a variant thereof comprising up to about 3 (for example about any of 1, 2, or 3) amino acid substitutions; and an LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 164, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions.
[0147] In some embodiments, the anti-E7MC antibody moiety comprises a heavy chain variable domain comprising an HC-CDR 1 comprising the amino acid sequence of SEQ ID NO: 59, an HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 80, and an HC- CDR3 comprising the amino acid sequence of SEQ ID NO: 101, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions in the HC-CDR sequences; and a light chain variable domain comprising an LC-CDRl comprising the amino acid sequence of SEQ ID NO: 122, an LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 143, and an LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 164, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions in the LC-CDR sequences.
[0148] In some embodiments, the anti-E7MC antibody moiety comprises a heavy chain variable domain comprising an HC-CDR 1 comprising the amino acid sequence of SEQ ID NO: 59, an HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 80, and an HC- CDR3 comprising the amino acid sequence of SEQ ID NO: 101; and a light chain variable domain comprising an LC-CDRl comprising the amino acid sequence of SEQ ID NO: 122, an LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 143, and an LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 164.
[0149] In some embodiments, the anti-E7MC antibody moiety comprises a heavy chain variable domain comprising an HC-CDR 1 comprising the amino acid sequence of SEQ ID
NO: 60, or a variant thereof comprising up to about 5 (for example about any of 1, 2, 3, 4, or
5) amino acid substitutions; an HC-CDR2 comprising the amino acid sequence of SEQ ID
NO: 81, or a variant thereof comprising up to about 5 (for example about any of 1, 2, 3, 4, or
5) amino acid substitutions; and an HC-CDR3 comprising the amino acid sequence of SEQ
ID NO: 102, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or
5) amino acid substitutions; and a light chain variable domain comprising an LC-CDRl comprising the amino acid sequence of SEQ ID NO: 123, or a variant thereof comprising up to about 5 (for example about any of 1, 2, 3, 4, or 5) amino acid substitutions; an LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 144, or a variant thereof comprising up to about 3 (for example about any of 1, 2, or 3) amino acid substitutions; and an LC-CDR3
comprising the amino acid sequence of SEQ ID NO: 165, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions.
[0150] In some embodiments, the anti-E7MC antibody moiety comprises a heavy chain variable domain comprising an HC-CDR 1 comprising the amino acid sequence of SEQ ID NO: 60, an HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 81, and an HC- CDR3 comprising the amino acid sequence of SEQ ID NO: 102, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions in the HC-CDR sequences; and a light chain variable domain comprising an LC-CDRl comprising the amino acid sequence of SEQ ID NO: 123, an LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 144, and an LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 165, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions in the LC-CDR sequences.
[0151] In some embodiments, the anti-E7MC antibody moiety comprises a heavy chain variable domain comprising an HC-CDR 1 comprising the amino acid sequence of SEQ ID NO: 60, an HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 81, and an HC- CDR3 comprising the amino acid sequence of SEQ ID NO: 102; and a light chain variable domain comprising an LC-CDRl comprising the amino acid sequence of SEQ ID NO: 123, an LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 144, and an LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 165.
[0152] In some embodiments, the anti-E7MC antibody moiety comprises a heavy chain variable domain comprising an HC-CDR 1 comprising the amino acid sequence of SEQ ID
NO: 61, or a variant thereof comprising up to about 5 (for example about any of 1, 2, 3, 4, or
5) amino acid substitutions; an HC-CDR2 comprising the amino acid sequence of SEQ ID
NO: 82, or a variant thereof comprising up to about 5 (for example about any of 1, 2, 3, 4, or
5) amino acid substitutions; and an HC-CDR3 comprising the amino acid sequence of SEQ
ID NO: 103, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or
5) amino acid substitutions; and a light chain variable domain comprising an LC-CDRl comprising the amino acid sequence of SEQ ID NO: 124, or a variant thereof comprising up to about 5 (for example about any of 1, 2, 3, 4, or 5) amino acid substitutions; an LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 145, or a variant thereof comprising up to about 3 (for example about any of 1, 2, or 3) amino acid substitutions; and an LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 166, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions.
[0153] In some embodiments, the anti-E7MC antibody moiety comprises a heavy chain variable domain comprising an HC-CDR 1 comprising the amino acid sequence of SEQ ID NO: 61, an HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 82, and an HC- CDR3 comprising the amino acid sequence of SEQ ID NO: 103, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions in the HC-CDR sequences; and a light chain variable domain comprising an LC-CDRl comprising the amino acid sequence of SEQ ID NO: 124, an LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 145, and an LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 166, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions in the LC-CDR sequences.
[0154] In some embodiments, the anti-E7MC antibody moiety comprises a heavy chain variable domain comprising an HC-CDR 1 comprising the amino acid sequence of SEQ ID NO: 61, an HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 82, and an HC- CDR3 comprising the amino acid sequence of SEQ ID NO: 103; and a light chain variable domain comprising an LC-CDRl comprising the amino acid sequence of SEQ ID NO: 124, an LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 145, and an LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 166.
[0155] In some embodiments, the anti-E7MC antibody moiety comprises a heavy chain variable domain comprising an HC-CDR 1 comprising the amino acid sequence of SEQ ID
NO: 62, or a variant thereof comprising up to about 5 (for example about any of 1, 2, 3, 4, or
5) amino acid substitutions; an HC-CDR2 comprising the amino acid sequence of SEQ ID
NO: 83, or a variant thereof comprising up to about 5 (for example about any of 1, 2, 3, 4, or
5) amino acid substitutions; and an HC-CDR3 comprising the amino acid sequence of SEQ
ID NO: 104, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or
5) amino acid substitutions; and a light chain variable domain comprising an LC-CDRl comprising the amino acid sequence of SEQ ID NO: 125, or a variant thereof comprising up to about 5 (for example about any of 1, 2, 3, 4, or 5) amino acid substitutions; an LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 146, or a variant thereof comprising up to about 3 (for example about any of 1, 2, or 3) amino acid substitutions; and an LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 167, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions.
[0156] In some embodiments, the anti-E7MC antibody moiety comprises a heavy chain variable domain comprising an HC-CDR 1 comprising the amino acid sequence of SEQ ID
NO: 62, an HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 83, and an HC- CDR3 comprising the amino acid sequence of SEQ ID NO: 104, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions in the HC-CDR sequences; and a light chain variable domain comprising an LC-CDRl comprising the amino acid sequence of SEQ ID NO: 125, an LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 146, and an LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 167, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions in the LC-CDR sequences.
[0157] In some embodiments, the anti-E7MC antibody moiety comprises a heavy chain variable domain comprising an HC-CDR 1 comprising the amino acid sequence of SEQ ID NO: 62, an HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 83, and an HC- CDR3 comprising the amino acid sequence of SEQ ID NO: 104; and a light chain variable domain comprising an LC-CDRl comprising the amino acid sequence of SEQ ID NO: 125, an LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 146, and an LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 167.
[0158] In some embodiments, the anti-E7MC antibody moiety comprises a heavy chain variable domain comprising an HC-CDR 1 comprising the amino acid sequence of SEQ ID
NO: 63, or a variant thereof comprising up to about 5 (for example about any of 1, 2, 3, 4, or
5) amino acid substitutions; an HC-CDR2 comprising the amino acid sequence of SEQ ID
NO: 84, or a variant thereof comprising up to about 5 (for example about any of 1, 2, 3, 4, or
5) amino acid substitutions; and an HC-CDR3 comprising the amino acid sequence of SEQ
ID NO: 105, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or
5) amino acid substitutions; and a light chain variable domain comprising an LC-CDRl comprising the amino acid sequence of SEQ ID NO: 126, or a variant thereof comprising up to about 5 (for example about any of 1, 2, 3, 4, or 5) amino acid substitutions; an LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 147, or a variant thereof comprising up to about 3 (for example about any of 1, 2, or 3) amino acid substitutions; and an LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 168, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions.
[0159] In some embodiments, the anti-E7MC antibody moiety comprises a heavy chain variable domain comprising an HC-CDR 1 comprising the amino acid sequence of SEQ ID
NO: 63, an HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 84, and an HC-
CDR3 comprising the amino acid sequence of SEQ ID NO: 105, or a variant thereof
comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions in the HC-CDR sequences; and a light chain variable domain comprising an LC-CDR1 comprising the amino acid sequence of SEQ ID NO: 126, an LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 147, and an LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 168, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions in the LC-CDR sequences.
[0160] In some embodiments, the anti-E7MC antibody moiety comprises a heavy chain variable domain comprising an HC-CDR 1 comprising the amino acid sequence of SEQ ID NO: 63, an HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 84, and an HC- CDR3 comprising the amino acid sequence of SEQ ID NO: 105; and a light chain variable domain comprising an LC-CDR1 comprising the amino acid sequence of SEQ ID NO: 126, an LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 147, and an LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 168.
[0161] In some embodiments, the anti-E7MC antibody moiety comprises a heavy chain variable domain comprising an HC-CDR 1 comprising the amino acid sequence of SEQ ID
NO: 64, or a variant thereof comprising up to about 5 (for example about any of 1, 2, 3, 4, or
5) amino acid substitutions; an HC-CDR2 comprising the amino acid sequence of SEQ ID
NO: 85, or a variant thereof comprising up to about 5 (for example about any of 1, 2, 3, 4, or
5) amino acid substitutions; and an HC-CDR3 comprising the amino acid sequence of SEQ
ID NO: 106, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or
5) amino acid substitutions; and a light chain variable domain comprising an LC-CDR1 comprising the amino acid sequence of SEQ ID NO: 127, or a variant thereof comprising up to about 5 (for example about any of 1, 2, 3, 4, or 5) amino acid substitutions; an LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 148, or a variant thereof comprising up to about 3 (for example about any of 1, 2, or 3) amino acid substitutions; and an LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 169, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions.
[0162] In some embodiments, the anti-E7MC antibody moiety comprises a heavy chain variable domain comprising an HC-CDR 1 comprising the amino acid sequence of SEQ ID
NO: 64, an HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 85, and an HC-
CDR3 comprising the amino acid sequence of SEQ ID NO: 106, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions in the
HC-CDR sequences; and a light chain variable domain comprising an LC-CDR1 comprising
the amino acid sequence of SEQ ID NO: 127, an LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 148, and an LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 169, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions in the LC-CDR sequences.
[0163] In some embodiments, the anti-E7MC antibody moiety comprises a heavy chain variable domain comprising an HC-CDR1 comprising the amino acid sequence of SEQ ID NO: 64, an HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 85, and an HC- CDR3 comprising the amino acid sequence of SEQ ID NO: 106; and a light chain variable domain comprising an LC-CDR1 comprising the amino acid sequence of SEQ ID NO: 127, an LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 148, and an LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 169.
[0164] In some embodiments, the anti-E7MC antibody moiety comprises a heavy chain variable domain comprising an HC-CDR1 comprising the amino acid sequence of SEQ ID
NO: 65, or a variant thereof comprising up to about 5 (for example about any of 1, 2, 3, 4, or
5) amino acid substitutions; an HC-CDR2 comprising the amino acid sequence of SEQ ID
NO: 86, or a variant thereof comprising up to about 5 (for example about any of 1, 2, 3, 4, or
5) amino acid substitutions; and an HC-CDR3 comprising the amino acid sequence of SEQ
ID NO: 107, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or
5) amino acid substitutions; and a light chain variable domain comprising an LC-CDR1 comprising the amino acid sequence of SEQ ID NO: 128, or a variant thereof comprising up to about 5 (for example about any of 1, 2, 3, 4, or 5) amino acid substitutions; an LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 149, or a variant thereof comprising up to about 3 (for example about any of 1, 2, or 3) amino acid substitutions; and an LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 170, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions.
[0165] In some embodiments, the anti-E7MC antibody moiety comprises a heavy chain variable domain comprising an HC-CDR1 comprising the amino acid sequence of SEQ ID
NO: 65, an HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 86, and an HC-
CDR3 comprising the amino acid sequence of SEQ ID NO: 107, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions in the
HC-CDR sequences; and a light chain variable domain comprising an LC-CDR1 comprising the amino acid sequence of SEQ ID NO: 128, an LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 149, and an LC-CDR3 comprising the amino acid sequence of SEQ
ID NO: 170, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions in the LC-CDR sequences.
[0166] In some embodiments, the anti-E7MC antibody moiety comprises a heavy chain variable domain comprising an HC-CDR 1 comprising the amino acid sequence of SEQ ID NO: 65, an HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 86, and an HC- CDR3 comprising the amino acid sequence of SEQ ID NO: 107; and a light chain variable domain comprising an LC-CDRl comprising the amino acid sequence of SEQ ID NO: 128, an LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 149, and an LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 170.
[0167] In some embodiments, the anti-E7MC antibody moiety comprises a heavy chain variable domain comprising an HC-CDR 1 comprising the amino acid sequence of SEQ ID
NO: 66, or a variant thereof comprising up to about 5 (for example about any of 1, 2, 3, 4, or
5) amino acid substitutions; an HC-CDR2 comprising the amino acid sequence of SEQ ID
NO: 87, or a variant thereof comprising up to about 5 (for example about any of 1, 2, 3, 4, or
5) amino acid substitutions; and an HC-CDR3 comprising the amino acid sequence of SEQ
ID NO: 108, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or
5) amino acid substitutions; and a light chain variable domain comprising an LC-CDRl comprising the amino acid sequence of SEQ ID NO: 129, or a variant thereof comprising up to about 5 (for example about any of 1, 2, 3, 4, or 5) amino acid substitutions; an LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 150, or a variant thereof comprising up to about 3 (for example about any of 1, 2, or 3) amino acid substitutions; and an LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 171, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions.
[0168] In some embodiments, the anti-E7MC antibody moiety comprises a heavy chain variable domain comprising an HC-CDR 1 comprising the amino acid sequence of SEQ ID
NO: 66, an HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 87, and an HC-
CDR3 comprising the amino acid sequence of SEQ ID NO: 108, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions in the
HC-CDR sequences; and a light chain variable domain comprising an LC-CDRl comprising the amino acid sequence of SEQ ID NO: 129, an LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 150, and an LC-CDR3 comprising the amino acid sequence of SEQ
ID NO: 171, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or
5) amino acid substitutions in the LC-CDR sequences.
[0169] In some embodiments, the anti-E7MC antibody moiety comprises a heavy chain variable domain comprising an HC-CDR 1 comprising the amino acid sequence of SEQ ID NO: 66, an HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 87, and an HC- CDR3 comprising the amino acid sequence of SEQ ID NO: 108; and a light chain variable domain comprising an LC-CDRl comprising the amino acid sequence of SEQ ID NO: 129, an LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 150, and an LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 171.
[0170] In some embodiments, the anti-E7MC antibody moiety comprises a heavy chain variable domain comprising an HC-CDR 1 comprising the amino acid sequence of SEQ ID NO: 67, or a variant thereof comprising up to about 5 (for example about any of 1, 2, 3, 4, or 5) amino acid substitutions; an HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 88, or a variant thereof comprising up to about 5 (for example about any of 1, 2, 3, 4, or 5) amino acid substitutions; and an HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 109, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions; and a light chain variable domain comprising an LC-CDRl comprising the amino acid sequence of SEQ ID NO: 130, or a variant thereof comprising up to about 5 (for example about any of 1, 2, 3, 4, or 5) amino acid substitutions; an LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 151, or a variant thereof comprising up to about 3 (for example about any of 1, 2, or 3) amino acid substitutions; and an LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 172, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions.
[0171] In some embodiments, the anti-E7MC antibody moiety comprises a heavy chain variable domain comprising an HC-CDR 1 comprising the amino acid sequence of SEQ ID NO: 67, an HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 88, and an HC- CDR3 comprising the amino acid sequence of SEQ ID NO: 109, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions in the HC-CDR sequences; and a light chain variable domain comprising an LC-CDRl comprising the amino acid sequence of SEQ ID NO: 130, an LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 151, and an LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 172, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions in the LC-CDR sequences.
[0172] In some embodiments, the anti-E7MC antibody moiety comprises a heavy chain variable domain comprising an HC-CDR 1 comprising the amino acid sequence of SEQ ID
NO: 67, an HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 88, and an HC- CDR3 comprising the amino acid sequence of SEQ ID NO: 109; and a light chain variable domain comprising an LC-CDRl comprising the amino acid sequence of SEQ ID NO: 130, an LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 151, and an LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 172.
[0173] In some embodiments, the anti-E7MC antibody moiety comprises a heavy chain variable domain comprising an HC-CDR 1 comprising the amino acid sequence of SEQ ID NO: 68, or a variant thereof comprising up to about 5 (for example about any of 1, 2, 3, 4, or 5) amino acid substitutions; an HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 89, or a variant thereof comprising up to about 5 (for example about any of 1, 2, 3, 4, or 5) amino acid substitutions; and an HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 110, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions; and a light chain variable domain comprising an LC-CDRl comprising the amino acid sequence of SEQ ID NO: 131, or a variant thereof comprising up to about 5 (for example about any of 1, 2, 3, 4, or 5) amino acid substitutions; an LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 152, or a variant thereof comprising up to about 3 (for example about any of 1, 2, or 3) amino acid substitutions; and an LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 173, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions.
[0174] In some embodiments, the anti-E7MC antibody moiety comprises a heavy chain variable domain comprising an HC-CDR 1 comprising the amino acid sequence of SEQ ID NO: 68, an HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 89, and an HC- CDR3 comprising the amino acid sequence of SEQ ID NO: 110, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions in the HC-CDR sequences; and a light chain variable domain comprising an LC-CDRl comprising the amino acid sequence of SEQ ID NO: 131, an LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 152, and an LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 173, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions in the LC-CDR sequences.
[0175] In some embodiments, the anti-E7MC antibody moiety comprises a heavy chain variable domain comprising an HC-CDR 1 comprising the amino acid sequence of SEQ ID
NO: 68, an HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 89, and an HC-
CDR3 comprising the amino acid sequence of SEQ ID NO: 110; and a light chain variable
domain comprising an LC-CDRl comprising the amino acid sequence of SEQ ID NO: 131, an LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 152, and an LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 173.
[0176] In some embodiments, the anti-E7MC antibody moiety comprises a heavy chain variable domain comprising an HC-CDR 1 comprising the amino acid sequence of SEQ ID NO: 69, or a variant thereof comprising up to about 5 (for example about any of 1, 2, 3, 4, or 5) amino acid substitutions; an HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 90, or a variant thereof comprising up to about 5 (for example about any of 1, 2, 3, 4, or 5) amino acid substitutions; and an HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 111, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions; and a light chain variable domain comprising an LC-CDRl comprising the amino acid sequence of SEQ ID NO: 132, or a variant thereof comprising up to about 5 (for example about any of 1, 2, 3, 4, or 5) amino acid substitutions; an LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 153, or a variant thereof comprising up to about 3 (for example about any of 1, 2, or 3) amino acid substitutions; and an LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 174, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions.
[0177] In some embodiments, the anti-E7MC antibody moiety comprises a heavy chain variable domain comprising an HC-CDR 1 comprising the amino acid sequence of SEQ ID NO: 69, an HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 90, and an HC- CDR3 comprising the amino acid sequence of SEQ ID NO: 111, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions in the HC-CDR sequences; and a light chain variable domain comprising an LC-CDRl comprising the amino acid sequence of SEQ ID NO: 132, an LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 153, and an LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 174, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions in the LC-CDR sequences.
[0178] In some embodiments, the anti-E7MC antibody moiety comprises a heavy chain variable domain comprising an HC-CDR 1 comprising the amino acid sequence of SEQ ID NO: 69, an HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 90, and an HC- CDR3 comprising the amino acid sequence of SEQ ID NO: 111; and a light chain variable domain comprising an LC-CDRl comprising the amino acid sequence of SEQ ID NO: 132,
an LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 153, and an LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 174.
[0179] In some embodiments, the anti-E7MC antibody moiety comprises a heavy chain variable domain comprising an HC-CDR 1 comprising the amino acid sequence of SEQ ID NO: 70, or a variant thereof comprising up to about 5 (for example about any of 1, 2, 3, 4, or 5) amino acid substitutions; an HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 91, or a variant thereof comprising up to about 5 (for example about any of 1, 2, 3, 4, or 5) amino acid substitutions; and an HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 112, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions; and a light chain variable domain comprising an LC-CDRl comprising the amino acid sequence of SEQ ID NO: 133, or a variant thereof comprising up to about 5 (for example about any of 1, 2, 3, 4, or 5) amino acid substitutions; an LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 154, or a variant thereof comprising up to about 3 (for example about any of 1, 2, or 3) amino acid substitutions; and an LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 175, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions.
[0180] In some embodiments, the anti-E7MC antibody moiety comprises a heavy chain variable domain comprising an HC-CDR 1 comprising the amino acid sequence of SEQ ID NO: 70, an HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 91, and an HC- CDR3 comprising the amino acid sequence of SEQ ID NO: 112, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions in the HC-CDR sequences; and a light chain variable domain comprising an LC-CDRl comprising the amino acid sequence of SEQ ID NO: 133, an LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 154, and an LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 175, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions in the LC-CDR sequences.
[0181] In some embodiments, the anti-E7MC antibody moiety comprises a heavy chain variable domain comprising an HC-CDR 1 comprising the amino acid sequence of SEQ ID
NO: 70, an HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 91, and an HC-
CDR3 comprising the amino acid sequence of SEQ ID NO: 112; and a light chain variable domain comprising an LC-CDRl comprising the amino acid sequence of SEQ ID NO: 133, an LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 154, and an LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 175.
[0182] In some embodiments, the anti-E7MC antibody moiety comprises a heavy chain variable domain comprising an HC-CDR 1 comprising the amino acid sequence of SEQ ID NO: 71, or a variant thereof comprising up to about 5 (for example about any of 1, 2, 3, 4, or 5) amino acid substitutions; an HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 92, or a variant thereof comprising up to about 5 (for example about any of 1, 2, 3, 4, or 5) amino acid substitutions; and an HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 113, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions; and a light chain variable domain comprising an LC-CDRl comprising the amino acid sequence of SEQ ID NO: 134, or a variant thereof comprising up to about 5 (for example about any of 1, 2, 3, 4, or 5) amino acid substitutions; an LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 155, or a variant thereof comprising up to about 3 (for example about any of 1, 2, or 3) amino acid substitutions; and an LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 176, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions.
[0183] In some embodiments, the anti-E7MC antibody moiety comprises a heavy chain variable domain comprising an HC-CDR 1 comprising the amino acid sequence of SEQ ID NO: 71, an HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 92, and an HC- CDR3 comprising the amino acid sequence of SEQ ID NO: 113, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions in the HC-CDR sequences; and a light chain variable domain comprising an LC-CDRl comprising the amino acid sequence of SEQ ID NO: 134, an LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 155, and an LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 176, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions in the LC-CDR sequences.
[0184] In some embodiments, the anti-E7MC antibody moiety comprises a heavy chain variable domain comprising an HC-CDR 1 comprising the amino acid sequence of SEQ ID NO: 71, an HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 92, and an HC- CDR3 comprising the amino acid sequence of SEQ ID NO: 113; and a light chain variable domain comprising an LC-CDRl comprising the amino acid sequence of SEQ ID NO: 134, an LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 155, and an LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 176.
[0185] In some embodiments, the anti-E7MC antibody moiety comprises a heavy chain variable domain comprising an HC-CDR 1 comprising the amino acid sequence of SEQ ID
NO: 72, or a variant thereof comprising up to about 5 (for example about any of 1, 2, 3, 4, or 5) amino acid substitutions; an HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 93, or a variant thereof comprising up to about 5 (for example about any of 1, 2, 3, 4, or 5) amino acid substitutions; and an HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 114, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions; and a light chain variable domain comprising an LC-CDRl comprising the amino acid sequence of SEQ ID NO: 135, or a variant thereof comprising up to about 5 (for example about any of 1, 2, 3, 4, or 5) amino acid substitutions; an LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 156, or a variant thereof comprising up to about 3 (for example about any of 1, 2, or 3) amino acid substitutions; and an LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 177, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions.
[0186] In some embodiments, the anti-E7MC antibody moiety comprises a heavy chain variable domain comprising an HC-CDR 1 comprising the amino acid sequence of SEQ ID NO: 72, an HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 93, and an HC- CDR3 comprising the amino acid sequence of SEQ ID NO: 114, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions in the HC-CDR sequences; and a light chain variable domain comprising an LC-CDRl comprising the amino acid sequence of SEQ ID NO: 135, an LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 156, and an LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 177, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions in the LC-CDR sequences.
[0187] In some embodiments, the anti-E7MC antibody moiety comprises a heavy chain variable domain comprising an HC-CDR 1 comprising the amino acid sequence of SEQ ID NO: 72, an HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 93, and an HC- CDR3 comprising the amino acid sequence of SEQ ID NO: 114; and a light chain variable domain comprising an LC-CDRl comprising the amino acid sequence of SEQ ID NO: 135, an LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 156, and an LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 177.
[0188] In some embodiments, the anti-E7MC antibody moiety comprises a heavy chain variable domain comprising an HC-CDR 1 comprising the amino acid sequence of SEQ ID
NO: 73, or a variant thereof comprising up to about 5 (for example about any of 1, 2, 3, 4, or
5) amino acid substitutions; an HC-CDR2 comprising the amino acid sequence of SEQ ID
NO: 94, or a variant thereof comprising up to about 5 (for example about any of 1, 2, 3, 4, or 5) amino acid substitutions; and an HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 115, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions; and a light chain variable domain comprising an LC-CDRl comprising the amino acid sequence of SEQ ID NO: 136, or a variant thereof comprising up to about 5 (for example about any of 1, 2, 3, 4, or 5) amino acid substitutions; an LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 157, or a variant thereof comprising up to about 3 (for example about any of 1, 2, or 3) amino acid substitutions; and an LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 178, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions.
[0189] In some embodiments, the anti-E7MC antibody moiety comprises a heavy chain variable domain comprising an HC-CDR 1 comprising the amino acid sequence of SEQ ID NO: 73, an HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 94, and an HC- CDR3 comprising the amino acid sequence of SEQ ID NO: 115, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions in the HC-CDR sequences; and a light chain variable domain comprising an LC-CDRl comprising the amino acid sequence of SEQ ID NO: 136, an LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 157, and an LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 178, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions in the LC-CDR sequences.
[0190] In some embodiments, the anti-E7MC antibody moiety comprises a heavy chain variable domain comprising an HC-CDR 1 comprising the amino acid sequence of SEQ ID NO: 73, an HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 94, and an HC- CDR3 comprising the amino acid sequence of SEQ ID NO: 115; and a light chain variable domain comprising an LC-CDRl comprising the amino acid sequence of SEQ ID NO: 136, an LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 157, and an LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 178.
[0191] In some embodiments, the anti-E7MC antibody moiety comprises a heavy chain variable domain comprising an HC-CDR 1 comprising the amino acid sequence of SEQ ID
NO: 74, or a variant thereof comprising up to about 5 (for example about any of 1, 2, 3, 4, or
5) amino acid substitutions; an HC-CDR2 comprising the amino acid sequence of SEQ ID
NO: 95, or a variant thereof comprising up to about 5 (for example about any of 1, 2, 3, 4, or
5) amino acid substitutions; and an HC-CDR3 comprising the amino acid sequence of SEQ
ID NO: 116, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions; and a light chain variable domain comprising an LC-CDRl comprising the amino acid sequence of SEQ ID NO: 137, or a variant thereof comprising up to about 5 (for example about any of 1, 2, 3, 4, or 5) amino acid substitutions; an LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 158, or a variant thereof comprising up to about 3 (for example about any of 1, 2, or 3) amino acid substitutions; and an LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 179, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions.
[0192] In some embodiments, the anti-E7MC antibody moiety comprises a heavy chain variable domain comprising an HC-CDR 1 comprising the amino acid sequence of SEQ ID NO: 74, an HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 95, and an HC- CDR3 comprising the amino acid sequence of SEQ ID NO: 116, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions in the HC-CDR sequences; and a light chain variable domain comprising an LC-CDRl comprising the amino acid sequence of SEQ ID NO: 137, an LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 158, and an LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 179, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions in the LC-CDR sequences.
[0193] In some embodiments, the anti-E7MC antibody moiety comprises a heavy chain variable domain comprising an HC-CDR 1 comprising the amino acid sequence of SEQ ID NO: 74, an HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 95, and an HC- CDR3 comprising the amino acid sequence of SEQ ID NO: 116; and a light chain variable domain comprising an LC-CDRl comprising the amino acid sequence of SEQ ID NO: 137, an LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 158, and an LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 179.
[0194] In some embodiments, the anti-E7MC antibody moiety comprises a heavy chain variable domain comprising an HC-CDR 1 comprising the amino acid sequence of SEQ ID
NO: 75, or a variant thereof comprising up to about 5 (for example about any of 1, 2, 3, 4, or
5) amino acid substitutions; an HC-CDR2 comprising the amino acid sequence of SEQ ID
NO: 96, or a variant thereof comprising up to about 5 (for example about any of 1, 2, 3, 4, or
5) amino acid substitutions; and an HC-CDR3 comprising the amino acid sequence of SEQ
ID NO: 117, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or
5) amino acid substitutions; and a light chain variable domain comprising an LC-CDRl
comprising the amino acid sequence of SEQ ID NO: 138, or a variant thereof comprising up to about 5 (for example about any of 1, 2, 3, 4, or 5) amino acid substitutions; an LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 159, or a variant thereof comprising up to about 3 (for example about any of 1, 2, or 3) amino acid substitutions; and an LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 180, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions.
[0195] In some embodiments, the anti-E7MC antibody moiety comprises a heavy chain variable domain comprising an HC-CDR 1 comprising the amino acid sequence of SEQ ID NO: 75, an HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 96, and an HC- CDR3 comprising the amino acid sequence of SEQ ID NO: 117, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions in the HC-CDR sequences; and a light chain variable domain comprising an LC-CDRl comprising the amino acid sequence of SEQ ID NO: 138, an LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 159, and an LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 180, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions in the LC-CDR sequences.
[0196] In some embodiments, the anti-E7MC antibody moiety comprises a heavy chain variable domain comprising an HC-CDR 1 comprising the amino acid sequence of SEQ ID NO: 75, an HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 96, and an HC- CDR3 comprising the amino acid sequence of SEQ ID NO: 117; and a light chain variable domain comprising an LC-CDRl comprising the amino acid sequence of SEQ ID NO: 138, an LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 159, and an LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 180.
[0197] In some embodiments, the anti-E7MC antibody moiety comprises a heavy chain variable domain comprising an HC-CDR 1 comprising the amino acid sequence of SEQ ID
NO: 76, or a variant thereof comprising up to about 5 (for example about any of 1, 2, 3, 4, or
5) amino acid substitutions; an HC-CDR2 comprising the amino acid sequence of SEQ ID
NO: 97, or a variant thereof comprising up to about 5 (for example about any of 1, 2, 3, 4, or
5) amino acid substitutions; and an HC-CDR3 comprising the amino acid sequence of SEQ
ID NO: 118, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or
5) amino acid substitutions; and a light chain variable domain comprising an LC-CDRl comprising the amino acid sequence of SEQ ID NO: 139, or a variant thereof comprising up to about 5 (for example about any of 1, 2, 3, 4, or 5) amino acid substitutions; an LC-CDR2
comprising the amino acid sequence of SEQ ID NO: 160, or a variant thereof comprising up to about 3 (for example about any of 1, 2, or 3) amino acid substitutions; and an LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 181, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions.
[0198] In some embodiments, the anti-E7MC antibody moiety comprises a heavy chain variable domain comprising an HC-CDR 1 comprising the amino acid sequence of SEQ ID NO: 76, an HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 97, and an HC- CDR3 comprising the amino acid sequence of SEQ ID NO: 118, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions in the HC-CDR sequences; and a light chain variable domain comprising an LC-CDRl comprising the amino acid sequence of SEQ ID NO: 139, an LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 160, and an LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 181, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions in the LC-CDR sequences.
[0199] In some embodiments, the anti-E7MC antibody moiety comprises a heavy chain variable domain comprising an HC-CDR 1 comprising the amino acid sequence of SEQ ID NO: 76, an HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 97, and an HC- CDR3 comprising the amino acid sequence of SEQ ID NO: 118; and a light chain variable domain comprising an LC-CDRl comprising the amino acid sequence of SEQ ID NO: 139, an LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 160, and an LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 181.
[0200] In some embodiments, the anti-E7MC antibody moiety comprises a heavy chain variable domain comprising an HC-CDR 1 comprising the amino acid sequence of SEQ ID
NO: 77, or a variant thereof comprising up to about 5 (for example about any of 1, 2, 3, 4, or
5) amino acid substitutions; an HC-CDR2 comprising the amino acid sequence of SEQ ID
NO: 98, or a variant thereof comprising up to about 5 (for example about any of 1, 2, 3, 4, or
5) amino acid substitutions; and an HC-CDR3 comprising the amino acid sequence of SEQ
ID NO: 119, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or
5) amino acid substitutions; and a light chain variable domain comprising an LC-CDRl comprising the amino acid sequence of SEQ ID NO: 140, or a variant thereof comprising up to about 5 (for example about any of 1, 2, 3, 4, or 5) amino acid substitutions; an LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 161, or a variant thereof comprising up to about 3 (for example about any of 1, 2, or 3) amino acid substitutions; and an LC-CDR3
comprising the amino acid sequence of SEQ ID NO: 182, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions.
[0201] In some embodiments, the anti-E7MC antibody moiety comprises a heavy chain variable domain comprising an HC-CDR 1 comprising the amino acid sequence of SEQ ID NO: 77, an HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 98, and an HC- CDR3 comprising the amino acid sequence of SEQ ID NO: 119, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions in the HC-CDR sequences; and a light chain variable domain comprising an LC-CDRl comprising the amino acid sequence of SEQ ID NO: 140, an LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 161, and an LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 182, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions in the LC-CDR sequences.
[0202] In some embodiments, the anti-E7MC antibody moiety comprises a heavy chain variable domain comprising an HC-CDR 1 comprising the amino acid sequence of SEQ ID NO: 77, an HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 98, and an HC- CDR3 comprising the amino acid sequence of SEQ ID NO: 119; and a light chain variable domain comprising an LC-CDRl comprising the amino acid sequence of SEQ ID NO: 140, an LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 161, and an LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 182.
[0203] In some embodiments, the anti-E7MC antibody moiety comprises a heavy chain variable domain comprising an HC-CDR 1 comprising the amino acid sequence of SEQ ID
NO: 77, or a variant thereof comprising up to about 5 (for example about any of 1, 2, 3, 4, or
5) amino acid substitutions; an HC-CDR2 comprising the amino acid sequence of SEQ ID
NO: 98, or a variant thereof comprising up to about 5 (for example about any of 1, 2, 3, 4, or
5) amino acid substitutions; and an HC-CDR3 comprising the amino acid sequence of SEQ
ID NO: 244, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or
5) amino acid substitutions; and a light chain variable domain comprising an LC-CDRl comprising the amino acid sequence of SEQ ID NO: 140, or a variant thereof comprising up to about 5 (for example about any of 1, 2, 3, 4, or 5) amino acid substitutions; an LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 161, or a variant thereof comprising up to about 3 (for example about any of 1, 2, or 3) amino acid substitutions; and an LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 182, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions.
[0204] In some embodiments, the anti-E7MC antibody moiety comprises a heavy chain variable domain comprising an HC-CDR 1 comprising the amino acid sequence of SEQ ID NO: 77, an HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 98, and an HC- CDR3 comprising the amino acid sequence of SEQ ID NO: 244, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions in the HC-CDR sequences; and a light chain variable domain comprising an LC-CDRl comprising the amino acid sequence of SEQ ID NO: 140, an LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 161, and an LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 182, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions in the LC-CDR sequences.
[0205] In some embodiments, the anti-E7MC antibody moiety comprises a heavy chain variable domain comprising an HC-CDR 1 comprising the amino acid sequence of SEQ ID NO: 77, an HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 98, and an HC- CDR3 comprising the amino acid sequence of SEQ ID NO: 244; and a light chain variable domain comprising an LC-CDRl comprising the amino acid sequence of SEQ ID NO: 140, an LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 161, and an LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 182.
[0206] In some embodiments, the anti-E7MC antibody moiety comprises a heavy chain variable domain comprising an HC-CDR 1 comprising the amino acid sequence of SEQ ID
NO: 77, or a variant thereof comprising up to about 5 (for example about any of 1, 2, 3, 4, or
5) amino acid substitutions; an HC-CDR2 comprising the amino acid sequence of SEQ ID
NO: 98, or a variant thereof comprising up to about 5 (for example about any of 1, 2, 3, 4, or
5) amino acid substitutions; and an HC-CDR3 comprising the amino acid sequence of SEQ
ID NO: 245, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or
5) amino acid substitutions; and a light chain variable domain comprising an LC-CDRl comprising the amino acid sequence of SEQ ID NO: 140, or a variant thereof comprising up to about 5 (for example about any of 1, 2, 3, 4, or 5) amino acid substitutions; an LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 161, or a variant thereof comprising up to about 3 (for example about any of 1, 2, or 3) amino acid substitutions; and an LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 182, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions.
[0207] In some embodiments, the anti-E7MC antibody moiety comprises a heavy chain variable domain comprising an HC-CDR 1 comprising the amino acid sequence of SEQ ID
NO: 77, an HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 98, and an HC- CDR3 comprising the amino acid sequence of SEQ ID NO: 245, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions in the HC-CDR sequences; and a light chain variable domain comprising an LC-CDRl comprising the amino acid sequence of SEQ ID NO: 140, an LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 161, and an LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 182, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions in the LC-CDR sequences.
[0208] In some embodiments, the anti-E7MC antibody moiety comprises a heavy chain variable domain comprising an HC-CDR 1 comprising the amino acid sequence of SEQ ID NO: 77, an HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 98, and an HC- CDR3 comprising the amino acid sequence of SEQ ID NO: 245; and a light chain variable domain comprising an LC-CDRl comprising the amino acid sequence of SEQ ID NO: 140, an LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 161, and an LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 182.
[0209] In some embodiments, the anti-E7MC antibody moiety comprises a heavy chain variable domain comprising an HC-CDR 1 comprising the amino acid sequence of SEQ ID
NO: 77, or a variant thereof comprising up to about 5 (for example about any of 1, 2, 3, 4, or
5) amino acid substitutions; an HC-CDR2 comprising the amino acid sequence of SEQ ID
NO: 98, or a variant thereof comprising up to about 5 (for example about any of 1, 2, 3, 4, or
5) amino acid substitutions; and an HC-CDR3 comprising the amino acid sequence of SEQ
ID NO: 119, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or
5) amino acid substitutions; and a light chain variable domain comprising an LC-CDRl comprising the amino acid sequence of SEQ ID NO: 140, or a variant thereof comprising up to about 5 (for example about any of 1, 2, 3, 4, or 5) amino acid substitutions; an LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 161, or a variant thereof comprising up to about 3 (for example about any of 1, 2, or 3) amino acid substitutions; and an LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 247, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions.
[0210] In some embodiments, the anti-E7MC antibody moiety comprises a heavy chain variable domain comprising an HC-CDR 1 comprising the amino acid sequence of SEQ ID
NO: 77, an HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 98, and an HC-
CDR3 comprising the amino acid sequence of SEQ ID NO: 119, or a variant thereof
comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions in the HC-CDR sequences; and a light chain variable domain comprising an LC-CDR1 comprising the amino acid sequence of SEQ ID NO: 140, an LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 161, and an LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 247, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions in the LC-CDR sequences.
[0211] In some embodiments, the anti-E7MC antibody moiety comprises a heavy chain variable domain comprising an HC-CDR 1 comprising the amino acid sequence of SEQ ID NO: 77, an HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 98, and an HC- CDR3 comprising the amino acid sequence of SEQ ID NO: 119; and a light chain variable domain comprising an LC-CDR1 comprising the amino acid sequence of SEQ ID NO: 140, an LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 161, and an LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 247.
[0212] In some embodiments, the anti-E7MC antibody moiety comprises a heavy chain variable domain comprising an HC-CDR 1 comprising the amino acid sequence of SEQ ID
NO: 77, or a variant thereof comprising up to about 5 (for example about any of 1, 2, 3, 4, or
5) amino acid substitutions; an HC-CDR2 comprising the amino acid sequence of SEQ ID
NO: 98, or a variant thereof comprising up to about 5 (for example about any of 1, 2, 3, 4, or
5) amino acid substitutions; and an HC-CDR3 comprising the amino acid sequence of SEQ
ID NO: 119, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or
5) amino acid substitutions; and a light chain variable domain comprising an LC-CDR1 comprising the amino acid sequence of SEQ ID NO: 140, or a variant thereof comprising up to about 5 (for example about any of 1, 2, 3, 4, or 5) amino acid substitutions; an LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 161, or a variant thereof comprising up to about 3 (for example about any of 1, 2, or 3) amino acid substitutions; and an LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 248, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions.
[0213] In some embodiments, the anti-E7MC antibody moiety comprises a heavy chain variable domain comprising an HC-CDR 1 comprising the amino acid sequence of SEQ ID
NO: 77, an HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 98, and an HC-
CDR3 comprising the amino acid sequence of SEQ ID NO: 119, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions in the
HC-CDR sequences; and a light chain variable domain comprising an LC-CDR1 comprising
the amino acid sequence of SEQ ID NO: 140, an LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 161, and an LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 248, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions in the LC-CDR sequences.
[0214] In some embodiments, the anti-E7MC antibody moiety comprises a heavy chain variable domain comprising an HC-CDR1 comprising the amino acid sequence of SEQ ID NO: 77, an HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 98, and an HC- CDR3 comprising the amino acid sequence of SEQ ID NO: 119; and a light chain variable domain comprising an LC-CDR1 comprising the amino acid sequence of SEQ ID NO: 140, an LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 161, and an LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 248.
[0215] In some embodiments, the anti-E7MC antibody moiety comprises a heavy chain variable domain comprising an HC-CDR1 comprising the amino acid sequence of SEQ ID
NO: 77, or a variant thereof comprising up to about 5 (for example about any of 1, 2, 3, 4, or
5) amino acid substitutions; an HC-CDR2 comprising the amino acid sequence of SEQ ID
NO: 98, or a variant thereof comprising up to about 5 (for example about any of 1, 2, 3, 4, or
5) amino acid substitutions; and an HC-CDR3 comprising the amino acid sequence of SEQ
ID NO: 119, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or
5) amino acid substitutions; and a light chain variable domain comprising an LC-CDR1 comprising the amino acid sequence of SEQ ID NO: 246, or a variant thereof comprising up to about 5 (for example about any of 1, 2, 3, 4, or 5) amino acid substitutions; an LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 161, or a variant thereof comprising up to about 3 (for example about any of 1, 2, or 3) amino acid substitutions; and an LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 182, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions.
[0216] In some embodiments, the anti-E7MC antibody moiety comprises a heavy chain variable domain comprising an HC-CDR1 comprising the amino acid sequence of SEQ ID
NO: 77, an HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 98, and an HC-
CDR3 comprising the amino acid sequence of SEQ ID NO: 119, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions in the
HC-CDR sequences; and a light chain variable domain comprising an LC-CDR1 comprising the amino acid sequence of SEQ ID NO: 246, an LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 161, and an LC-CDR3 comprising the amino acid sequence of SEQ
ID NO: 182, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions in the LC-CDR sequences.
[0217] In some embodiments, the anti-E7MC antibody moiety comprises a heavy chain variable domain comprising an HC-CDR 1 comprising the amino acid sequence of SEQ ID NO: 77, an HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 98, and an HC- CDR3 comprising the amino acid sequence of SEQ ID NO: 119; and a light chain variable domain comprising an LC-CDRl comprising the amino acid sequence of SEQ ID NO: 246, an LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 161, and an LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 182.
[0218] In some embodiments, the anti-E7MC antibody moiety comprises a heavy chain variable domain comprising an HC-CDR 1 comprising the amino acid sequence of SEQ ID
NO: 77, or a variant thereof comprising up to about 5 (for example about any of 1, 2, 3, 4, or
5) amino acid substitutions; an HC-CDR2 comprising the amino acid sequence of SEQ ID
NO: 98, or a variant thereof comprising up to about 5 (for example about any of 1, 2, 3, 4, or
5) amino acid substitutions; and an HC-CDR3 comprising the amino acid sequence of SEQ
ID NO: 119, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or
5) amino acid substitutions; and a light chain variable domain comprising an LC-CDRl comprising the amino acid sequence of SEQ ID NO: 140, or a variant thereof comprising up to about 5 (for example about any of 1, 2, 3, 4, or 5) amino acid substitutions; an LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 161, or a variant thereof comprising up to about 3 (for example about any of 1, 2, or 3) amino acid substitutions; and an LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 249, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions.
[0219] In some embodiments, the anti-E7MC antibody moiety comprises a heavy chain variable domain comprising an HC-CDR 1 comprising the amino acid sequence of SEQ ID
NO: 77, an HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 98, and an HC-
CDR3 comprising the amino acid sequence of SEQ ID NO: 119, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions in the
HC-CDR sequences; and a light chain variable domain comprising an LC-CDRl comprising the amino acid sequence of SEQ ID NO: 140, an LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 161, and an LC-CDR3 comprising the amino acid sequence of SEQ
ID NO: 249, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or
5) amino acid substitutions in the LC-CDR sequences.
[0220] In some embodiments, the anti-E7MC antibody moiety comprises a heavy chain variable domain comprising an HC-CDR 1 comprising the amino acid sequence of SEQ ID NO: 77, an HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 98, and an HC- CDR3 comprising the amino acid sequence of SEQ ID NO: 119; and a light chain variable domain comprising an LC-CDRl comprising the amino acid sequence of SEQ ID NO: 140, an LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 161, and an LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 249.
[0221] In some embodiments, the anti-E7MC antibody moiety comprises a heavy chain variable domain comprising an HC-CDR 1 comprising the amino acid sequence of SEQ ID NO: 77, or a variant thereof comprising up to about 5 (for example about any of 1, 2, 3, 4, or 5) amino acid substitutions; an HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 98, or a variant thereof comprising up to about 5 (for example about any of 1, 2, 3, 4, or 5) amino acid substitutions; and an HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 119, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions; and a light chain variable domain comprising an LC-CDRl comprising the amino acid sequence of SEQ ID NO: 140, or a variant thereof comprising up to about 5 (for example about any of 1, 2, 3, 4, or 5) amino acid substitutions; an LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 161, or a variant thereof comprising up to about 3 (for example about any of 1, 2, or 3) amino acid substitutions; and an LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 250, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions.
[0222] In some embodiments, the anti-E7MC antibody moiety comprises a heavy chain variable domain comprising an HC-CDR 1 comprising the amino acid sequence of SEQ ID NO: 77, an HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 98, and an HC- CDR3 comprising the amino acid sequence of SEQ ID NO: 119, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions in the HC-CDR sequences; and a light chain variable domain comprising an LC-CDRl comprising the amino acid sequence of SEQ ID NO: 140, an LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 161, and an LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 250, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions in the LC-CDR sequences.
[0223] In some embodiments, the anti-E7MC antibody moiety comprises a heavy chain variable domain comprising an HC-CDR 1 comprising the amino acid sequence of SEQ ID
NO: 77, an HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 98, and an HC- CDR3 comprising the amino acid sequence of SEQ ID NO: 119; and a light chain variable domain comprising an LC-CDR1 comprising the amino acid sequence of SEQ ID NO: 140, an LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 161, and an LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 250.
[0224] In some embodiments, the anti-E7MC antibody moiety comprises a heavy chain variable domain comprising the amino acid sequence set forth in SEQ ID NO: 15, or a variant thereof having at least about 95% (for example at least about any of 96%, 97%, 98%, or 99%) sequence identity, and a light chain variable domain comprising the amino acid sequence set forth in SEQ ID NO: 36, or a variant thereof having at least about 95% (including for example at least about any of 96%, 97%, 98%, or 99%) sequence identity. In some embodiments, the anti-E7MC antibody moiety comprises a heavy chain variable domain comprising the amino acid sequence set forth in SEQ ID NO: 15 and a light chain variable domain comprising the amino acid sequence set forth in SEQ ID NO: 36.
[0225] In some embodiments, the anti-E7MC antibody moiety comprises a heavy chain variable domain comprising the amino acid sequence set forth in SEQ ID NO: 16, or a variant thereof having at least about 95% (including for example at least about any of 96%, 97%, 98%, or 99%) sequence identity, and a light chain variable domain comprising the amino acid sequence set forth in SEQ ID NO: 37, or a variant thereof having at least about 95%
(including for example at least about any of 96%, 97%, 98%, or 99%) sequence identity. In some embodiments, the anti-E7MC antibody moiety comprises a heavy chain variable domain comprising the amino acid sequence set forth in SEQ ID NO: 16 and a light chain variable domain comprising the amino acid sequence set forth in SEQ ID NO: 37.
[0226] In some embodiments, the anti-E7MC antibody moiety comprises a heavy chain variable domain comprising the amino acid sequence set forth in SEQ ID NO: 17, or a variant thereof having at least about 95% (for example at least about any of 96%, 97%, 98%, or 99%) sequence identity, and a light chain variable domain comprising the amino acid sequence set forth in SEQ ID NO: 38, or a variant thereof having at least about 95% (including for example at least about any of 96%, 97%, 98%, or 99%) sequence identity. In some embodiments, the anti-E7MC antibody moiety comprises a heavy chain variable domain comprising the amino acid sequence set forth in SEQ ID NO: 17 and a light chain variable domain comprising the amino acid sequence set forth in SEQ ID NO: 38.
[0227] In some embodiments, the anti-E7MC antibody moiety comprises a heavy chain variable domain comprising the amino acid sequence set forth in SEQ ID NO: 18, or a variant thereof having at least about 95% (for example at least about any of 96%, 97%, 98%, or 99%) sequence identity, and a light chain variable domain comprising the amino acid sequence set forth in SEQ ID NO: 39, or a variant thereof having at least about 95% (including for example at least about any of 96%, 97%, 98%, or 99%) sequence identity. In some embodiments, the anti-E7MC antibody moiety comprises a heavy chain variable domain comprising the amino acid sequence set forth in SEQ ID NO: 18 and a light chain variable domain comprising the amino acid sequence set forth in SEQ ID NO: 39.
[0228] In some embodiments, the anti-E7MC antibody moiety comprises a heavy chain variable domain comprising the amino acid sequence set forth in SEQ ID NO: 19, or a variant thereof having at least about 95% (for example at least about any of 96%, 97%, 98%, or 99%) sequence identity, and a light chain variable domain comprising the amino acid sequence set forth in SEQ ID NO: 40, or a variant thereof having at least about 95% (including for example at least about any of 96%, 97%, 98%, or 99%) sequence identity. In some embodiments, the anti-E7MC antibody moiety comprises a heavy chain variable domain comprising the amino acid sequence set forth in SEQ ID NO: 19 and a light chain variable domain comprising the amino acid sequence set forth in SEQ ID NO: 40.
[0229] In some embodiments, the anti-E7MC antibody moiety comprises a heavy chain variable domain comprising the amino acid sequence set forth in SEQ ID NO: 20, or a variant thereof having at least about 95% (for example at least about any of 96%, 97%, 98%, or 99%) sequence identity, and a light chain variable domain comprising the amino acid sequence set forth in SEQ ID NO: 41, or a variant thereof having at least about 95% (including for example at least about any of 96%, 97%, 98%, or 99%) sequence identity. In some embodiments, the anti-E7MC antibody moiety comprises a heavy chain variable domain comprising the amino acid sequence set forth in SEQ ID NO: 20 and a light chain variable domain comprising the amino acid sequence set forth in SEQ ID NO: 41.
[0230] In some embodiments, the anti-E7MC antibody moiety comprises a heavy chain variable domain comprising the amino acid sequence set forth in SEQ ID NO: 21, or a variant thereof having at least about 95% (for example at least about any of 96%, 97%, 98%, or 99%) sequence identity, and a light chain variable domain comprising the amino acid sequence set forth in SEQ ID NO: 42, or a variant thereof having at least about 95% (including for example at least about any of 96%, 97%, 98%, or 99%) sequence identity. In some
embodiments, the anti-E7MC antibody moiety comprises a heavy chain variable domain comprising the amino acid sequence set forth in SEQ ID NO: 21 and a light chain variable domain comprising the amino acid sequence set forth in SEQ ID NO: 42.
[0231] In some embodiments, the anti-E7MC antibody moiety comprises a heavy chain variable domain comprising the amino acid sequence set forth in SEQ ID NO: 22, or a variant thereof having at least about 95% (including for example at least about any of 96%, 97%,
98%, or 99%) sequence identity, and a light chain variable domain comprising the amino acid sequence set forth in SEQ ID NO: 43, or a variant thereof having at least about 95%
(including for example at least about any of 96%, 97%, 98%, or 99%) sequence identity. In some embodiments, the anti-E7MC antibody moiety comprises a heavy chain variable domain comprising the amino acid sequence set forth in SEQ ID NO: 22 and a light chain variable domain comprising the amino acid sequence set forth in SEQ ID NO: 43.
[0232] In some embodiments, the anti-E7MC antibody moiety comprises a heavy chain variable domain comprising the amino acid sequence set forth in SEQ ID NO: 23, or a variant thereof having at least about 95% (for example at least about any of 96%, 97%, 98%, or 99%) sequence identity, and a light chain variable domain comprising the amino acid sequence set forth in SEQ ID NO: 44, or a variant thereof having at least about 95% (including for example at least about any of 96%, 97%, 98%, or 99%) sequence identity. In some embodiments, the anti-E7MC antibody moiety comprises a heavy chain variable domain comprising the amino acid sequence set forth in SEQ ID NO: 23 and a light chain variable domain comprising the amino acid sequence set forth in SEQ ID NO: 44.
[0233] In some embodiments, the anti-E7MC antibody moiety comprises a heavy chain variable domain comprising the amino acid sequence set forth in SEQ ID NO: 24, or a variant thereof having at least about 95% (including for example at least about any of 96%, 97%,
98%, or 99%) sequence identity, and a light chain variable domain comprising the amino acid sequence set forth in SEQ ID NO: 45, or a variant thereof having at least about 95%
(including for example at least about any of 96%, 97%, 98%, or 99%) sequence identity. In some embodiments, the anti-E7MC antibody moiety comprises a heavy chain variable domain comprising the amino acid sequence set forth in SEQ ID NO: 24 and a light chain variable domain comprising the amino acid sequence set forth in SEQ ID NO: 45.
[0234] In some embodiments, the anti-E7MC antibody moiety comprises a heavy chain variable domain comprising the amino acid sequence set forth in SEQ ID NO: 25, or a variant thereof having at least about 95% (including for example at least about any of 96%, 97%,
98%, or 99%) sequence identity, and a light chain variable domain comprising the amino acid sequence set forth in SEQ ID NO: 46, or a variant thereof having at least about 95%
(including for example at least about any of 96%, 97%, 98%, or 99%) sequence identity. In some embodiments, the anti-E7MC antibody moiety comprises a heavy chain variable domain comprising the amino acid sequence set forth in SEQ ID NO: 25 and a light chain variable domain comprising the amino acid sequence set forth in SEQ ID NO: 46.
[0235] In some embodiments, the anti-E7MC antibody moiety comprises a heavy chain variable domain comprising the amino acid sequence set forth in SEQ ID NO: 26, or a variant thereof having at least about 95% (including for example at least about any of 96%, 97%,
98%, or 99%) sequence identity, and a light chain variable domain comprising the amino acid sequence set forth in SEQ ID NO: 47, or a variant thereof having at least about 95%
(including for example at least about any of 96%, 97%, 98%, or 99%) sequence identity. In some embodiments, the anti-E7MC antibody moiety comprises a heavy chain variable domain comprising the amino acid sequence set forth in SEQ ID NO: 26 and a light chain variable domain comprising the amino acid sequence set forth in SEQ ID NO: 47.
[0236] In some embodiments, the anti-E7MC antibody moiety comprises a heavy chain variable domain comprising the amino acid sequence set forth in SEQ ID NO: 27, or a variant thereof having at least about 95% (including for example at least about any of 96%, 97%,
98%, or 99%) sequence identity, and a light chain variable domain comprising the amino acid sequence set forth in SEQ ID NO: 48, or a variant thereof having at least about 95%
(including for example at least about any of 96%, 97%, 98%, or 99%) sequence identity. In some embodiments, the anti-E7MC antibody moiety comprises a heavy chain variable domain comprising the amino acid sequence set forth in SEQ ID NO: 27 and a light chain variable domain comprising the amino acid sequence set forth in SEQ ID NO: 48.
[0237] In some embodiments, the anti-E7MC antibody moiety comprises a heavy chain variable domain comprising the amino acid sequence set forth in SEQ ID NO: 28, or a variant thereof having at least about 95% (including for example at least about any of 96%, 97%,
98%, or 99%) sequence identity, and a light chain variable domain comprising the amino acid sequence set forth in SEQ ID NO: 49, or a variant thereof having at least about 95%
(including for example at least about any of 96%, 97%, 98%, or 99%) sequence identity. In some embodiments, the anti-E7MC antibody moiety comprises a heavy chain variable domain comprising the amino acid sequence set forth in SEQ ID NO: 28 and a light chain variable domain comprising the amino acid sequence set forth in SEQ ID NO: 49.
[0238] In some embodiments, the anti-E7MC antibody moiety comprises a heavy chain variable domain comprising the amino acid sequence set forth in SEQ ID NO: 29, or a variant thereof having at least about 95% (including for example at least about any of 96%, 97%,
98%, or 99%) sequence identity, and a light chain variable domain comprising the amino acid sequence set forth in SEQ ID NO: 50, or a variant thereof having at least about 95%
(including for example at least about any of 96%, 97%, 98%, or 99%) sequence identity. In some embodiments, the anti-E7MC antibody moiety comprises a heavy chain variable domain comprising the amino acid sequence set forth in SEQ ID NO: 29 and a light chain variable domain comprising the amino acid sequence set forth in SEQ ID NO: 50.
[0239] In some embodiments, the anti-E7MC antibody moiety comprises a heavy chain variable domain comprising the amino acid sequence set forth in SEQ ID NO: 30, or a variant thereof having at least about 95% (including for example at least about any of 96%, 97%,
98%, or 99%) sequence identity, and a light chain variable domain comprising the amino acid sequence set forth in SEQ ID NO: 51, or a variant thereof having at least about 95%
(including for example at least about any of 96%, 97%, 98%, or 99%) sequence identity. In some embodiments, the anti-E7MC antibody moiety comprises a heavy chain variable domain comprising the amino acid sequence set forth in SEQ ID NO: 30 and a light chain variable domain comprising the amino acid sequence set forth in SEQ ID NO: 51.
[0240] In some embodiments, the anti-E7MC antibody moiety comprises a heavy chain variable domain comprising the amino acid sequence set forth in SEQ ID NO: 31, or a variant thereof having at least about 95% (including for example at least about any of 96%, 97%,
98%, or 99%) sequence identity, and a light chain variable domain comprising the amino acid sequence set forth in SEQ ID NO: 52, or a variant thereof having at least about 95%
(including for example at least about any of 96%, 97%, 98%, or 99%) sequence identity. In some embodiments, the anti-E7MC antibody moiety comprises a heavy chain variable domain comprising the amino acid sequence set forth in SEQ ID NO: 31 and a light chain variable domain comprising the amino acid sequence set forth in SEQ ID NO: 52.
[0241] In some embodiments, the anti-E7MC antibody moiety comprises a heavy chain variable domain comprising the amino acid sequence set forth in SEQ ID NO: 32, or a variant thereof having at least about 95% (including for example at least about any of 96%, 97%,
98%, or 99%) sequence identity, and a light chain variable domain comprising the amino acid sequence set forth in SEQ ID NO: 53, or a variant thereof having at least about 95%
(including for example at least about any of 96%, 97%, 98%, or 99%) sequence identity. In
some embodiments, the anti-E7MC antibody moiety comprises a heavy chain variable domain comprising the amino acid sequence set forth in SEQ ID NO: 32 and a light chain variable domain comprising the amino acid sequence set forth in SEQ ID NO: 53.
[0242] In some embodiments, the anti-E7MC antibody moiety comprises a heavy chain variable domain comprising the amino acid sequence set forth in SEQ ID NO: 33, or a variant thereof having at least about 95% (including for example at least about any of 96%, 97%,
98%, or 99%) sequence identity, and a light chain variable domain comprising the amino acid sequence set forth in SEQ ID NO: 54, or a variant thereof having at least about 95%
(including for example at least about any of 96%, 97%, 98%, or 99%) sequence identity. In some embodiments, the anti-E7MC antibody moiety comprises a heavy chain variable domain comprising the amino acid sequence set forth in SEQ ID NO: 33 and a light chain variable domain comprising the amino acid sequence set forth in SEQ ID NO: 54.
[0243] In some embodiments, the anti-E7MC antibody moiety comprises a heavy chain variable domain comprising the amino acid sequence set forth in SEQ ID NO: 34, or a variant thereof having at least about 95% (including for example at least about any of 96%, 97%,
98%, or 99%) sequence identity, and a light chain variable domain comprising the amino acid sequence set forth in SEQ ID NO: 55, or a variant thereof having at least about 95%
(including for example at least about any of 96%, 97%, 98%, or 99%) sequence identity. In some embodiments, the anti-E7MC antibody moiety comprises a heavy chain variable domain comprising the amino acid sequence set forth in SEQ ID NO: 34 and a light chain variable domain comprising the amino acid sequence set forth in SEQ ID NO: 55.
[0244] In some embodiments, the anti-E7MC antibody moiety comprises a heavy chain variable domain comprising the amino acid sequence set forth in SEQ ID NO: 35, or a variant thereof having at least about 95% (including for example at least about any of 96%, 97%,
98%, or 99%) sequence identity, and a light chain variable domain comprising the amino acid sequence set forth in SEQ ID NO: 56, or a variant thereof having at least about 95%
(including for example at least about any of 96%, 97%, 98%, or 99%) sequence identity. In some embodiments, the anti-E7MC antibody moiety comprises a heavy chain variable domain comprising the amino acid sequence set forth in SEQ ID NO: 35 and a light chain variable domain comprising the amino acid sequence set forth in SEQ ID NO: 56.
[0245] In some embodiments, the anti-E7MC antibody moiety comprises a heavy chain variable domain comprising the amino acid sequence set forth in SEQ ID NO: 233, or a variant thereof having at least about 95% (including for example at least about any of 96%,
97%, 98%, or 99%) sequence identity, and a light chain variable domain comprising the amino acid sequence set forth in SEQ ID NO: 56, or a variant thereof having at least about
95% (including for example at least about any of 96%, 97%, 98%, or 99%) sequence identity.
In some embodiments, the anti-E7MC antibody moiety comprises a heavy chain variable domain comprising the amino acid sequence set forth in SEQ ID NO: 233 and a light chain variable domain comprising the amino acid sequence set forth in SEQ ID NO: 56.
[0246] In some embodiments, the anti-E7MC antibody moiety comprises a heavy chain variable domain comprising the amino acid sequence set forth in SEQ ID NO: 234, or a variant thereof having at least about 95% (including for example at least about any of 96%,
97%, 98%, or 99%) sequence identity, and a light chain variable domain comprising the amino acid sequence set forth in SEQ ID NO: 56, or a variant thereof having at least about
95% (including for example at least about any of 96%, 97%, 98%, or 99%) sequence identity.
In some embodiments, the anti-E7MC antibody moiety comprises a heavy chain variable domain comprising the amino acid sequence set forth in SEQ ID NO: 234 and a light chain variable domain comprising the amino acid sequence set forth in SEQ ID NO: 56.
[0247] In some embodiments, the anti-E7MC antibody moiety comprises a heavy chain variable domain comprising the amino acid sequence set forth in SEQ ID NO: 235, or a variant thereof having at least about 95% (including for example at least about any of 96%,
97%, 98%, or 99%) sequence identity, and a light chain variable domain comprising the amino acid sequence set forth in SEQ ID NO: 56, or a variant thereof having at least about
95% (including for example at least about any of 96%, 97%, 98%, or 99%) sequence identity.
In some embodiments, the anti-E7MC antibody moiety comprises a heavy chain variable domain comprising the amino acid sequence set forth in SEQ ID NO: 235 and a light chain variable domain comprising the amino acid sequence set forth in SEQ ID NO: 56.
[0248] In some embodiments, the anti-E7MC antibody moiety comprises a heavy chain variable domain comprising the amino acid sequence set forth in SEQ ID NO: 35, or a variant thereof having at least about 95% (including for example at least about any of 96%, 97%,
98%, or 99%) sequence identity, and a light chain variable domain comprising the amino acid sequence set forth in SEQ ID NO: 238, or a variant thereof having at least about 95%
(including for example at least about any of 96%, 97%, 98%, or 99%) sequence identity. In some embodiments, the anti-E7MC antibody moiety comprises a heavy chain variable domain comprising the amino acid sequence set forth in SEQ ID NO: 35 and a light chain variable domain comprising the amino acid sequence set forth in SEQ ID NO: 238.
[0249] In some embodiments, the anti-E7MC antibody moiety comprises a heavy chain variable domain comprising the amino acid sequence set forth in SEQ ID NO: 35, or a variant thereof having at least about 95% (including for example at least about any of 96%, 97%,
98%, or 99%) sequence identity, and a light chain variable domain comprising the amino acid sequence set forth in SEQ ID NO: 239, or a variant thereof having at least about 95%
(including for example at least about any of 96%, 97%, 98%, or 99%) sequence identity. In some embodiments, the anti-E7MC antibody moiety comprises a heavy chain variable domain comprising the amino acid sequence set forth in SEQ ID NO: 35 and a light chain variable domain comprising the amino acid sequence set forth in SEQ ID NO: 239.
[0250] In some embodiments, the anti-E7MC antibody moiety comprises a heavy chain variable domain comprising the amino acid sequence set forth in SEQ ID NO: 35, or a variant thereof having at least about 95% (including for example at least about any of 96%, 97%,
98%, or 99%) sequence identity, and a light chain variable domain comprising the amino acid sequence set forth in SEQ ID NO: 240, or a variant thereof having at least about 95%
(including for example at least about any of 96%, 97%, 98%, or 99%) sequence identity. In some embodiments, the anti-E7MC antibody moiety comprises a heavy chain variable domain comprising the amino acid sequence set forth in SEQ ID NO: 35 and a light chain variable domain comprising the amino acid sequence set forth in SEQ ID NO: 240.
[0251] In some embodiments, the anti-E7MC antibody moiety comprises a heavy chain variable domain comprising the amino acid sequence set forth in SEQ ID NO: 35, or a variant thereof having at least about 95% (including for example at least about any of 96%, 97%,
98%, or 99%) sequence identity, and a light chain variable domain comprising the amino acid sequence set forth in SEQ ID NO: 241, or a variant thereof having at least about 95%
(including for example at least about any of 96%, 97%, 98%, or 99%) sequence identity. In some embodiments, the anti-E7MC antibody moiety comprises a heavy chain variable domain comprising the amino acid sequence set forth in SEQ ID NO: 35 and a light chain variable domain comprising the amino acid sequence set forth in SEQ ID NO: 241.
[0252] In some embodiments, the anti-E7MC antibody moiety comprises a heavy chain variable domain comprising the amino acid sequence set forth in SEQ ID NO: 35, or a variant thereof having at least about 95% (including for example at least about any of 96%, 97%,
98%, or 99%) sequence identity, and a light chain variable domain comprising the amino acid sequence set forth in SEQ ID NO: 242, or a variant thereof having at least about 95%
(including for example at least about any of 96%, 97%, 98%, or 99%) sequence identity. In
some embodiments, the anti-E7MC antibody moiety comprises a heavy chain variable domain comprising the amino acid sequence set forth in SEQ ID NO: 35 and a light chain variable domain comprising the amino acid sequence set forth in SEQ ID NO: 242.
[0253] In some embodiments, the anti-E7MC antibody moiety comprises a heavy chain variable domain comprising the amino acid sequence set forth in SEQ ID NO: 236, or a variant thereof having at least about 95% (including for example at least about any of 96%, 97%, 98%, or 99%) sequence identity, and a light chain variable domain comprising the amino acid sequence set forth in SEQ ID NO: 243, or a variant thereof having at least about 95% (including for example at least about any of 96%, 97%, 98%, or 99%) sequence identity. In some embodiments, the anti-E7MC antibody moiety comprises a heavy chain variable domain comprising the amino acid sequence set forth in SEQ ID NO: 236 and a light chain variable domain comprising the amino acid sequence set forth in SEQ ID NO: 243.
[0254] In some embodiments, the anti-E7MC antibody moiety comprises a heavy chain variable domain comprising the amino acid sequence set forth in SEQ ID NO: 237, or a variant thereof having at least about 95% (including for example at least about any of 96%, 97%, 98%, or 99%) sequence identity, and a light chain variable domain comprising the amino acid sequence set forth in SEQ ID NO: 56, or a variant thereof having at least about 95% (including for example at least about any of 96%, 97%, 98%, or 99%) sequence identity. In some embodiments, the anti-E7MC antibody moiety comprises a heavy chain variable domain comprising the amino acid sequence set forth in SEQ ID NO: 237 and a light chain variable domain comprising the amino acid sequence set forth in SEQ ID NO: 56.
[0255] In some embodiments, the anti-E7MC antibody moiety competes for binding to a target HPV16-E7/MHC class I complex with a second anti-E7MC antibody moiety according to any of the anti-E7MC antibody moieties described herein. In some embodiments, the anti- E7MC antibody moiety binds to the same, or substantially the same, epitope as the second anti-E7MC antibody moiety. In some embodiments, binding of the anti-E7MC antibody moiety to the target HPV16-E7/MHC class I complex inhibits binding of the second anti- E7MC antibody moiety to the target HPV16-E7/MHC class I complex by at least about 70% (such as by at least about any of 75%, 80%, 85%, 90%, 95%, 98% or 99%), or vice versa. In some embodiments, the anti-E7MC antibody moiety and the second anti-E7MC antibody moiety cross-compete for binding to the target HPV16-E7/MHC class I complex, i.e., each of the antibody moieties competes with the other for binding to the target HPV16-E7/MHC class I complex.
[0256] For example, in some embodiments, the anti-E7MC antibody moiety competes for binding to a target HPV16-E7/MHC class I complex with an antibody moiety comprising i) a heavy chain variable domain sequence comprising an HC-CDR1 comprising the amino acid sequence of SEQ ID NO: 183, or a variant thereof comprising up to about 3 (for example about any of 1, 2, or 3) amino acid substitutions, an HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 184 or 185, or a variant thereof comprising up to about 3 (for example about any of 1, 2, or 3) amino acid substitutions, and an HC-CDR3 comprising the amino acid sequence of any one of SEQ ID NOs: 186-188; or a variant thereof comprising up to about 3 (for example about any of 1, 2, or 3) amino acid substitutions; and ii) a light chain variable domain comprising an LC-CDRl comprising the amino acid sequence of SEQ ID NO: 189 or 190, or a variant thereof comprising up to about 3 (for example about any of 1, 2, or 3) amino acid substitutions, and an LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 191, or a variant thereof comprising up to about 3 (for example about any of 1, 2, or 3) amino acid substitutions.
[0257] In some embodiments, the anti-E7MC antibody moiety competes for binding to a target HPV16-E7/MHC class I complex with an antibody moiety comprising i) a heavy chain variable domain sequence comprising an HC-CDR1 comprising (and in some embodiments consisting of) the amino acid sequence of any one of SEQ ID NOs: 57-77; or a variant thereof comprising up to about 5 (for example about any of 1, 2, 3, 4, or 5) amino acid substitutions; an HC-CDR2 comprising (and in some embodiments consisting of) the amino acid sequence of any one of SEQ ID NOs: 78-98; or a variant thereof comprising up to about 5 (for example about any of 1, 2, 3, 4, or 5) amino acid substitutions; and an HC-CDR3 comprising (and in some embodiments consisting of) the amino acid sequence of any one of SEQ ID NOs: 99-119, 244, and 245; or a variant thereof comprising up to about 5 (for example about any of 1, 2, 3, 4, or 5) amino acid substitutions; and ii) a light chain variable domain sequence comprising an LC-CDRl comprising (and in some embodiments consisting of) the amino acid sequence of any one of SEQ ID NOs: 120-140 and 246; or a variant thereof comprising up to about 5 (for example about any of 1, 2, 3, 4, or 5) amino acid substitutions; an LC-CDR2 comprising (and in some embodiments consisting of) the amino acid sequence of any one of SEQ ID NOs: 141-161; or a variant thereof comprising up to about 3 (for example about any of 1, 2, or 3) amino acid substitutions; and an LC-CDR3 comprising (and in some embodiments consisting of) the amino acid sequence of any one of
SEQ ID NOs: 162-182 and 247-250; or a variant thereof comprising up to about 5 (for example about any of 1, 2, 3, 4, or 5) amino acid substitutions.
[0258] In some embodiments, the anti-E7MC antibody moiety competes for binding to a target HPV16-E7/MHC class I complex with an antibody moiety comprising i) a heavy chain variable domain sequence comprising an HC-CDR1 comprising (and in some embodiments consisting of) the amino acid sequence of any one of SEQ ID NOs: 57-77; an HC-CDR2 comprising (and in some embodiments consisting of) the amino acid sequence of any one of SEQ ID NOs: 78-98; and an HC-CDR3 comprising (and in some embodiments consisting of) the amino acid sequence of any one of SEQ ID NOs: 99-119, 244, and 245; or a variant thereof comprising up to about 5 (for example about any of 1, 2, 3, 4, or 5) amino acid substitutions in the HC-CDR sequences; and ii) a light chain variable domain sequence comprising an LC-CDR1 comprising (and in some embodiments consisting of) the amino acid sequence of any one of SEQ ID NOs: 120-140 and 246; an LC-CDR2 comprising (and in some embodiments consisting of) the amino acid sequence of any one of SEQ ID NOs: 141-161; and an LC-CDR3 comprising (and in some embodiments consisting of) the amino acid sequence of any one of SEQ ID NOs: 162-182 and 247-250; or a variant thereof comprising up to about 5 (for example about any of 1, 2, 3, 4, or 5) amino acid substitutions in the LC-CDR sequences.
[0259] In some embodiments, the anti-E7MC antibody moiety competes for binding to a target HPV16-E7/MHC class I complex with an antibody moiety comprising a heavy chain variable domain comprising (and in some embodiments consisting of) the amino acid sequence of any one of SEQ ID NOs: 15-35 and 233-237, or a variant thereof having at least about 95% (for example at least about any of 96%, 97%, 98%, or 99%) sequence identity, and a light chain variable domain comprising (and in some embodiments consisting of) the amino acid sequence of any one of SEQ ID NOs: 36-56 and 238-243, or a variant thereof having at least about 95% (for example at least about any of 96%, 97%, 98%, or 99%) sequence identity.
Full-length anti-E7MC antibodies
[0260] The anti-E7MC constructs in some embodiments are full-length antibodies comprising an anti-E7MC antibody moiety (also referred to herein as a "full-length anti- E7MC antibody"). In some embodiments, the full-length antibody is a monoclonal antibody.
[0261] In some embodiments, the full-length anti-E7MC antibody comprises an Fc sequence from an immunoglobulin, such as IgA, IgD, IgE, IgG, and IgM. In some embodiments, the full-length anti-E7MC antibody comprises an Fc sequence of IgG, such as any of IgGl, IgG2, IgG3, or IgG4. In some embodiments, the full-length anti-E7MC antibody comprises an Fc sequence of a human immunoglobulin. In some embodiments, the full-length anti-E7MC antibody comprises an Fc sequence of a mouse immunoglobulin. In some embodiments, the full-length anti-E7MC antibody comprises an Fc sequence that has been altered or otherwise changed so that it has enhanced antibody dependent cellular cytotoxicity (ADCC) or complement dependent cytotoxicity (CDC) effector function.
[0262] Thus, for example, in some embodiments, there is provided a full-length anti-E7MC antibody comprising a) an anti-E7MC antibody moiety that specifically binds to a complex comprising an HPV16-E7 peptide and an MHC class I protein, and b) an Fc region. In some embodiments, the HPV16-E7 peptide is HPV16-E7 11-19 (SEQ ID NO: 4). In some embodiments, the MHC class I protein is HLA-A02. In some embodiments, the MHC class I protein is HLA-A*02:01. In some embodiments, there is provided a full-length anti-E7MC antibody comprising a) an anti-E7MC antibody moiety that specifically binds to a complex comprising an HPV16-E7 11-19 peptide (SEQ ID NO: 4) and HLA-A*02:01, and b) an Fc region. In some embodiments, the Fc region comprises an IgGl Fc sequence. In some embodiments, the Fc region comprises a human IgGl Fc sequence. In some embodiments, the Fc region comprises a mouse IgGl Fc sequence. In some embodiments, the anti-E7MC antibody moiety cross-reacts with at least one (such as at least any of 2, 3, 4, 5, or 6) complex comprising the MHC class I protein and a variant of the HPV16-E7 peptide having one amino acid substitution (such as a conservative amino acid substitution). In some
embodiments, the anti-E7MC antibody moiety cross-reacts with at least one (such as at least any of 2, 3, 4, or 5) complex comprising the HPV16-E7 peptide and a different subtype of the MHC class I protein.
[0263] In some embodiments, there is provided a full-length anti-E7MC antibody comprising a) an anti-E7MC antibody moiety that specifically binds to a complex comprising an HPV16-E7 peptide and an MHC class I protein comprising i) a heavy chain variable domain sequence comprising an HC-CDR1 comprising the amino acid sequence of SEQ ID
NO: 183, or a variant thereof comprising up to about 3 (for example about any of 1, 2, or 3) amino acid substitutions, an HC-CDR2 comprising the amino acid sequence of SEQ ID NO:
184 or 185, or a variant thereof comprising up to about 3 (for example about any of 1, 2, or 3)
amino acid substitutions, and an HC-CDR3 comprising the amino acid sequence of any one of SEQ ID NOs: 186-188; or a variant thereof comprising up to about 3 (for example about any of 1, 2, or 3) amino acid substitutions; and ii) a light chain variable domain comprising an LC-CDR1 comprising the amino acid sequence of SEQ ID NO: 189 or 190, or a variant thereof comprising up to about 3 (for example about any of 1, 2, or 3) amino acid
substitutions, and an LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 191, or a variant thereof comprising up to about 3 (for example about any of 1, 2, or 3) amino acid substitutions, and b) an Fc region. In some embodiments, the Fc region comprises an IgGl Fc sequence. In some embodiments, the Fc region comprises a human IgGl Fc sequence. In some embodiments, the Fc region comprises a mouse IgGl Fc sequence.
[0264] In some embodiments, there is provided a full-length anti-E7MC antibody comprising a) an anti-E7MC antibody moiety that specifically binds to a complex comprising an HPV16-E7 peptide and an MHC class I protein comprising i) a heavy chain variable domain sequence comprising an HC-CDR1 comprising the amino acid sequence of SEQ ID
NO: 183, an HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 184 or 185, and an HC-CDR3 comprising the amino acid sequence of any one of SEQ ID NOs: 186-188; and ii) a light chain variable domain comprising an LC-CDR1 comprising the amino acid sequence of SEQ ID NO: 189 or 190, and an LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 191, and b) an Fc region. In some embodiments, the Fc region comprises an
IgGl Fc sequence. In some embodiments, the Fc region comprises a human IgGl Fc sequence. In some embodiments, the Fc region comprises a mouse IgGl Fc sequence.
[0265] In some embodiments, there is provided a full-length anti-E7MC antibody comprising a) an anti-E7MC antibody moiety that specifically binds to a complex comprising an HPV16-E7 peptide and an MHC class I protein comprising i) a heavy chain variable domain comprising an HC-CDR1 comprising the amino acid sequence of any one of SEQ ID
NOs: 57-77, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or
5) amino acid substitutions, an HC-CDR2 comprising the amino acid sequence of any one of
SEQ ID NOs: 78-98, or a variant thereof comprising up to about 5 (such as about any of 1, 2,
3, 4, or 5) amino acid substitutions, and an HC-CDR3 comprising the amino acid sequence of any one of SEQ ID NOs: 99-119, 244, and 245, or a variant thereof comprising up to about 5
(such as about any of 1, 2, 3, 4, or 5) amino acid substitutions; and ii) a light chain variable domain comprising an LC-CDR1 comprising the amino acid sequence of any one of SEQ ID
NOs: 120-140 and 246, or a variant thereof comprising up to about 5 (such as about any of 1,
2, 3, 4, or 5) amino acid substitutions, an LC-CDR2 comprising the amino acid sequence of any one of SEQ ID NOs: 141-161, or a variant thereof comprising up to about 3 (such as about any of 1, 2, or 3) amino acid substitutions, and an LC-CDR3 comprising the amino acid sequence of any one of SEQ ID NOs: 162-182 and 247-250, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions. In some embodiments, the Fc region comprises an IgGl Fc sequence. In some embodiments, the Fc region comprises a human IgGl Fc sequence. In some embodiments, the Fc region comprises a mouse IgGl Fc sequence.
[0266] In some embodiments, there is provided a full-length anti-E7MC antibody comprising a) an anti-E7MC antibody moiety that specifically binds to a complex comprising an HPV16-E7 peptide and an MHC class I protein comprising i) a heavy chain variable domain sequence comprising an HC-CDR1 comprising the amino acid sequence of any one of SEQ ID NOs: 57-77; an HC-CDR2 comprising the amino acid sequence of any one of
SEQ ID NOs: 78-98; and an HC-CDR3 comprising the amino acid sequence of any one of
SEQ ID NOs: 99-119, 244, and 245; or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions in the HC-CDR sequences; and ii) a light chain variable domain sequence comprising an LC-CDR1 comprising the amino acid sequence of any one of SEQ ID NOs: 120-140 and 246; an LC-CDR2 comprising the amino acid sequence of any one of SEQ ID NOs: 141-161; and an LC-CDR3 comprising the amino acid sequence of any one of SEQ ID NOs: 162-182 and 247-250; or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions in the
LC-CDR sequences; and b) an Fc region. In some embodiments, the Fc region comprises an
IgGl Fc sequence. In some embodiments, the Fc region comprises a human IgGl Fc sequence. In some embodiments, the Fc region comprises a mouse IgGl Fc sequence.
[0267] In some embodiments, there is provided a full-length anti-E7MC antibody comprising a) an anti-E7MC antibody moiety that specifically binds to a complex comprising an HPV16-E7 peptide and an MHC class I protein comprising i) a heavy chain variable domain sequence comprising an HC-CDR 1 comprising the amino acid sequence of any one of SEQ ID NOs: 57-77; an HC-CDR2 comprising the amino acid sequence of any one of
SEQ ID NOs: 78-98; and an HC-CDR3 comprising the amino acid sequence of any one of
SEQ ID NOs: 99-119, 244, and 245; and ii) a light chain variable domain sequence comprising an LC-CDR 1 comprising the amino acid sequence of any one of SEQ ID NOs:
120-140 and 246; an LC-CDR2 comprising the amino acid sequence of any one of SEQ ID
NOs: 141-161; and an LC-CDR3 comprising the amino acid sequence of any one of SEQ ID NOs: 162-182 and 247-250; and b) an Fc region. In some embodiments, the Fc region comprises an IgGl Fc sequence. In some embodiments, the Fc region comprises a human IgGl Fc sequence. In some embodiments, the Fc region comprises a mouse IgGl Fc sequence.
[0268] In some embodiments, there is provided a full-length anti-E7MC antibody comprising a) an anti-E7MC antibody moiety that specifically binds to a complex comprising an HPV16-E7 peptide and an MHC class I protein comprising a heavy chain variable domain comprising the amino acid sequence of any one of SEQ ID NOs: 15-35 and 233-237, or a variant thereof having at least about 95% (for example at least about any of 96%, 97%, 98%, or 99%) sequence identity, and a light chain variable domain comprising the amino acid sequence of any one of SEQ ID NOs: 36-56 and 238-243, or a variant thereof having at least about 95% (including for example at least about any of 96%, 97%, 98%, or 99%) sequence identity; and b) an Fc region. In some embodiments, the Fc region comprises an IgGl Fc sequence. In some embodiments, the Fc region comprises a human IgGl Fc sequence. In some embodiments, the Fc region comprises a mouse IgGl Fc sequence.
[0269] In some embodiments, there is provided a full-length anti-E7MC antibody comprising a) an anti-E7MC antibody moiety that specifically binds to a complex comprising an HPV16-E7 peptide and an MHC class I protein comprising a heavy chain variable domain comprising the amino acid sequence of any one of SEQ ID NOs: 15-35 and 233-237 and a light chain variable domain comprising the amino acid sequence of any one of SEQ ID NOs: 36-56 and 238-243; and b) an Fc region. In some embodiments, the Fc region comprises an IgGl Fc sequence. In some embodiments, the Fc region comprises a human IgGl Fc sequence. In some embodiments, the Fc region comprises a mouse IgGl Fc sequence.
[0270] In some embodiments, the full-length anti-E7MC antibody binds to a complex comprising an HPV16-E7 peptide and an MHC class I protein with a Kd between about 0.1 pM to about 500 nM (such as about any of 0.1 pM, 1.0 pM, 10 pM, 50 pM, 100 pM, 500 pM, 1 nM, 10 nM, 50 nM, 100 nM, or 500 nM, including any ranges between these values). In some embodiments, the full-length anti-E7MC antibody binds to a complex comprising an HPV16-E7 peptide and an MHC class I protein with a Kd between about 1 pM to about 250 pM (such as about any of 1, 10, 25, 50, 75, 100, 150, 200, or 250 pM, including any ranges between these values).
Multi-Specific anti-E7MC molecules
[0271] The anti-E7MC constructs in some embodiments comprise a multi- specific anti- E7MC molecule comprising an anti-E7MC antibody moiety and a second binding moiety (such as a second antigen-binding moiety). In some embodiments, the multi- specific anti- E7MC molecule comprises an anti-E7MC antibody moiety and a second antigen-binding moiety.
[0272] Multi- specific molecules are molecules that have binding specificities for at least two different antigens or epitopes (e.g., bispecific antibodies have binding specificities for two antigens or epitopes). Multi- specific molecules with more than two valencies and/or specificities are also contemplated. For example, trispecific antibodies can be prepared. Tutt et al. J. Immunol. 147: 60 (1991). It is to be appreciated that one of skill in the art could select appropriate features of individual multi- specific molecules described herein to combine with one another to form a multi-specific anti-E7MC molecule of the invention.
[0273] Thus, for example, in some embodiments, there is provided a multi- specific (e.g. , bispecific) anti-E7MC molecule comprising a) an anti-E7MC antibody moiety that specifically binds to a complex comprising an HPV16-E7 peptide and an MHC class I protein, and b) a second binding moiety (such as an antigen-binding moiety). In some embodiments, the second binding moiety specifically binds to a complex comprising a different HPV16-E7 peptide bound to the MHC class I protein. In some embodiments, the second scFv specifically binds to a complex comprising the HPV16-E7 peptide bound to a different MHC class I protein. In some embodiments, the second binding moiety specifically binds to a different epitope on the complex comprising the HPV16-E7 peptide and the MHC class I protein. In some embodiments, the second binding moiety specifically binds to a different antigen. In some embodiments, the second binding moiety specifically binds to an antigen on the surface of a cell, such as a cytotoxic cell. In some embodiments, the second binding moiety specifically binds to an antigen on the surface of a lymphocyte, such as a T cell, an NK cell, a neutrophil, a monocyte, a macrophage, or a dendritic cell. In some embodiments, the second binding moiety specifically binds to an effector T cell, such as a cytotoxic T cell (also known as cytotoxic T lymphocyte (CTL) or T killer cell).
[0274] In some embodiments, there is provided a multi- specific anti-E7MC molecule comprising a) an anti-E7MC antibody moiety that specifically binds to a complex comprising an HPV16-E7 peptide and an MHC class I protein, and b) a second antigen-binding moiety that binds specifically to CD3. In some embodiments, the second antigen-binding moiety
specifically binds to CD3s. In some embodiments, the second antigen-binding moiety specifically binds to an agonistic epitope of CD3s. The term "agonistic epitope", as used herein, means (a) an epitope that, upon binding of the multi- specific molecule, optionally upon binding of several multi- specific molecules on the same cell, allows said multi- specific molecules to activate TCR signaling and induce T cell activation, and/or (b) an epitope that is solely composed of amino acid residues of the epsilon chain of CD3 and is accessible for binding by the multi- specific molecule, when presented in its natural context on T cells (i.e. surrounded by the TCR, the CD3y chain, etc.), and/or (c) an epitope that, upon binding of the multi- specific molecule, does not lead to stabilization of the spatial position of CD3s relative to CD3y.
[0275] In some embodiments, there is provided a multi- specific anti-E7MC molecule comprising a) an anti-E7MC antibody moiety that specifically binds to a complex comprising an HPV16-E7 peptide and an MHC class I protein, and b) a second antigen-binding moiety that binds specifically to an antigen on the surface of an effector cell, including for example CD3y, CD35, CD3s, CD3C, CD28, CD16a, CD56, CD68, and GDS2D.
[0276] In some embodiments, there is provided a multi- specific anti-E7MC molecule comprising a) an anti-E7MC antibody moiety that specifically binds to a complex comprising an HPV16-E7 peptide and an MHC class I protein, and b) a second antigen-binding moiety that binds specifically to a component of the complement system, such as Clq. Clq is a subunit of the CI enzyme complex that activates the serum complement system.
[0277] In some embodiments, the second antigen-binding moiety specifically binds to an Fc receptor. In some embodiments, the second antigen -binding moiety specifically binds to an Fey receptor (FcyR). The FcyR may be an FcyRIII present on the surface of natural killer (NK) cells or one of FcyRI, FcyRIIA, FcyRIIBI, FcyRIIB2, and FcyRIIIB present on the surface of macrophages, monocytes, neutrophils and/or dendritic cells. In some embodiments, the second antigen-binding moiety is an Fc region or functional fragment thereof. A
"functional fragment" as used in this context refers to a fragment of an antibody Fc region that is still capable of binding to an FcR, in particular to an FcyR, with sufficient specificity and affinity to allow an FcyR bearing effector cell, in particular a macrophage, a monocyte, a neutrophil and/or a dendritic cell, to kill the target cell by cytotoxic lysis or phagocytosis. A functional Fc fragment is capable of competitively inhibiting the binding of the original, full- length Fc portion to an FcR such as the activating FcyRI. In some embodiments, a functional
Fc fragment retains at least 30%, 40%, 50%, 60%, 70%, 80%, 90% or 95% of its affinity to
an activating FcyR. In some embodiments, the Fc region or functional fragment thereof is an enhanced Fc region or functional fragment thereof. The term "enhanced Fc region", as used herein, refers to an Fc region that is modified to enhance Fc receptor-mediated effector- functions, in particular antibody-dependent cell-mediated cytotoxicity (ADCC), complement- dependent cytotoxicity (CDC), and antibody-mediated phagocytosis. This can be achieved as known in the art, for example by altering the Fc region in a way that leads to an increased affinity for an activating receptor (e.g. FcyRIIIA (CD16A) expressed on natural killer (NK) cells) and/or a decreased binding to an inhibitory receptor (e.g. FcyRIIB l/B2 (CD32B)). In yet other embodiments, the second antigen -binding moiety is an antibody or antigen-binding fragment thereof that specifically binds to an FcR, in particular to an FcyR, with sufficient specificity and affinity to allow an FcyR bearing effector cell, in particular a macrophage, a monocyte, a neutrophil and/or a dendritic cell, to kill the target cell by cytotoxic lysis or phagocytosis.
[0278] In some embodiments, the multi- specific anti-E7MC molecule allows killing of E7MC-presenting target cells and/or can effectively redirect CTLs to lyse E7MC-presenting target cells. In some embodiments, the multi- specific (e.g. , bispecific) anti-E7MC molecule of the present invention shows an in vitro EC50 ranging from 10 to 500 ng/ml, and is able to induce redirected lysis of about 50% of the target cells through CTLs at a ratio of CTLs to target cells of from about 1 : 1 to about 50: 1 (such as from about 1 : 1 to about 15: 1, or from about 2: 1 to about 10: 1).
[0279] In some embodiments, the multi- specific (e.g. , bispecific) anti-E7MC molecule is capable of cross-linking a stimulated or unstimulated CTL and the target cell in such a way that the target cell is lysed. This offers the advantage that no generation of target- specific T cell clones or common antigen presentation by dendritic cells is required for the multi- specific anti-E7MC molecule to exert its desired activity. In some embodiments, the multi- specific anti-E7MC molecule of the present invention is capable of redirecting CTLs to lyse the target cells in the absence of other activating signals. In some embodiments, the second antigen-binding moiety of the multi- specific anti-E7MC molecule specifically binds to CD3 (e.g. , specifically binds to CD3s), and signaling through CD28 and/or IL-2 is not required for redirecting CTLs to lyse the target cells.
[0280] Methods for measuring the preference of the multi- specific anti-E7MC molecule to simultaneously bind to two antigens (e.g. , antigens on two different cells) are within the normal capabilities of a person skilled in the art. For example, when the second binding
moiety specifically binds to CD3, the multi- specific anti-E7MC molecule may be contacted with a mixture of CD3+/HPV16-E7" cells and CD37HPV16-E7+ cells. The number of multi- specific anti-E7MC molecule-positive single cells and the number of cells cross-linked by multi- specific anti-E7MC molecules may then be assessed by microscopy or fluorescence- activated cell sorting (FACS) as known in the art.
[0281] For example, in some embodiments, there is provided a multi- specific anti-E7MC molecule comprising a) an anti-E7MC antibody moiety that specifically binds to a complex comprising an HPV16-E7 peptide and an MHC class I protein, and b) a second antigen- binding moiety. In some embodiments, the HPV16-E7 peptide is HPV16-E7 11-19 (SEQ ID NO: 4). In some embodiments, the MHC class I protein is HLA-A02. In some embodiments, the MHC class I protein is HLA-A*02:01. In some embodiments, the second antigen-binding moiety specifically binds to a complex comprising a different HPV16-E7 peptide bound to the MHC class I protein. In some embodiments, the second antigen-binding moiety specifically binds to a complex comprising the HPV16-E7 peptide bound to a different MHC class I protein. In some embodiments, the second antigen-binding moiety specifically binds to a different epitope on the complex comprising the HPV16-E7 peptide and the MHC class I protein. In some embodiments, the second antigen-binding moiety specifically binds to another antigen. In some embodiments, the second antigen-binding moiety specifically binds to an antigen on the surface of a cell, such as an E7MC-presenting cell. In some
embodiments, the second antigen-binding moiety specifically binds to an antigen on the surface of a cell that does not express HPV16-E7. In some embodiments, the second antigen- binding moiety specifically binds to an antigen on the surface of a cytotoxic cell. In some embodiments, the second antigen-binding moiety specifically binds to an antigen on the surface of a lymphocyte, such as a T cell, an NK cell, a neutrophil, a monocyte, a
macrophage, or a dendritic cell. In some embodiments, the second antigen-binding moiety specifically binds to an antigen on the surface of an effector T cell, such as a cytotoxic T cell. In some embodiments, the second antigen-binding moiety specifically binds to an antigen on the surface of an effector cell, including for example CD3y, CD35, CD3s, CD3ζ, CD28, CD16a, CD56, CD68, and GDS2D. In some embodiments, the anti-E7MC antibody moiety is human, humanized, or semi- synthetic. In some embodiments, the second antigen-binding moiety is an antibody moiety. In some embodiments, the second antigen-binding moiety is a human, humanized, or semi- synthetic antibody moiety. In some embodiments, the multi- specific anti-E7MC molecule further comprises at least one (such as at least about any of 2, 3,
4, 5, or more) additional antigen-binding moieties. In some embodiments, the anti-E7MC antibody moiety cross-reacts with at least one (such as at least any of 2, 3, 4, 5, or 6) complex comprising the MHC class I protein and a variant of the HPV16-E7 peptide having one amino acid substitution (such as a conservative amino acid substitution). In some
embodiments, the anti-E7MC antibody moiety cross-reacts with at least one (such as at least any of 2, 3, 4, or 5) complex comprising the HPV16-E7 peptide and a different subtype of the MHC class I protein.
[0282] In some embodiments, there is provided a multi- specific anti-E7MC molecule comprising a) an anti-E7MC antibody moiety that specifically binds to a complex comprising an HPV16-E7 11-19 peptide (SEQ ID NO: 4) and HLA-A*02:01, and b) a second antigen- binding moiety.
[0283] In some embodiments, there is provided a multi- specific anti-E7MC molecule comprising a) an anti-E7MC antibody moiety that specifically binds to a complex comprising an HPV16-E7 peptide and an MHC class I protein comprising i) a heavy chain variable domain sequence comprising an HC-CDR1 comprising the amino acid sequence of SEQ ID NO: 183, or a variant thereof comprising up to about 3 (for example about any of 1, 2, or 3) amino acid substitutions, an HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 184 or 185, or a variant thereof comprising up to about 3 (for example about any of 1, 2, or 3) amino acid substitutions, and an HC-CDR3 comprising the amino acid sequence of any one of SEQ ID NOs: 186-188, or a variant thereof comprising up to about 3 (for example about any of 1, 2, or 3) amino acid substitutions; and ii) a light chain variable domain comprising an LC-CDR1 comprising the amino acid sequence of SEQ ID NO: 189 or 190, or a variant thereof comprising up to about 3 (for example about any of 1, 2, or 3) amino acid
substitutions, and an LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 191, or a variant thereof comprising up to about 3 (for example about any of 1, 2, or 3) amino acid substitutions, and b) a second antigen-binding moiety.
[0284] In some embodiments, there is provided a multi- specific anti-E7MC molecule comprising a) an anti-E7MC antibody moiety that specifically binds to a complex comprising an HPV16-E7 peptide and an MHC class I protein comprising i) a heavy chain variable domain sequence comprising an HC-CDR1 comprising the amino acid sequence of SEQ ID
NO: 183, an HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 184 or 185, and an HC-CDR3 comprising the amino acid sequence of any one of SEQ ID NOs: 186-188; and ii) a light chain variable domain comprising an LC-CDR1 comprising the amino acid
sequence of SEQ ID NO: 189 or 190, and an LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 191, and b) a second antigen-binding moiety.
[0285] In some embodiments, there is provided a multi- specific anti-E7MC molecule comprising a) an anti-E7MC antibody moiety that specifically binds to a complex comprising an HPV16-E7 peptide and an MHC class I protein comprising i) a heavy chain variable domain comprising an HC-CDR1 comprising the amino acid sequence of any one of SEQ ID NOs: 57-77, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions, an HC-CDR2 comprising the amino acid sequence of any one of SEQ ID NOs: 78-98, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions, and an HC-CDR3 comprising the amino acid sequence of any one of SEQ ID NOs: 99-119, 244, and 245, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions; and ii) a light chain variable domain comprising an LC-CDR1 comprising the amino acid sequence of any one of SEQ ID NOs: 120-140 and 246, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions, an LC-CDR2 comprising the amino acid sequence of any one of SEQ ID NOs: 141-161, or a variant thereof comprising up to about 3 (such as about any of 1, 2, or 3) amino acid substitutions, and an LC-CDR3 comprising the amino acid sequence of any one of SEQ ID NOs: 162-182 and 247-250, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions; and b) a second antigen-binding moiety.
[0286] In some embodiments, there is provided a multi- specific anti-E7MC molecule comprising a) an anti-E7MC antibody moiety that specifically binds to a complex comprising an HPV16-E7 peptide and an MHC class I protein comprising i) a heavy chain variable domain sequence comprising an HC-CDR1 comprising the amino acid sequence of any one of SEQ ID NOs: 57-77; an HC-CDR2 comprising the amino acid sequence of any one of SEQ ID NOs: 78-98; and an HC-CDR3 comprising the amino acid sequence of any one of SEQ ID NOs: 99-119, 244, and 245; or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions in the HC-CDR sequences; and ii) a light chain variable domain sequence comprising an LC-CDR1 comprising the amino acid sequence of any one of SEQ ID NOs: 120-140 and 246; an LC-CDR2 comprising the amino acid sequence of any one of SEQ ID NOs: 141-161; and an LC-CDR3 comprising the amino acid sequence of any one of SEQ ID NOs: 162-182 and 247-250; or a variant thereof
comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions in the LC-CDR sequences; and b) a second antigen-binding moiety.
[0287] In some embodiments, there is provided a multi- specific anti-E7MC molecule comprising a) an anti-E7MC antibody moiety that specifically binds to a complex comprising an HPV16-E7 peptide and an MHC class I protein comprising i) a heavy chain variable domain sequence comprising an HC-CDR1 comprising the amino acid sequence of any one of SEQ ID NOs: 57-77; an HC-CDR2 comprising the amino acid sequence of any one of SEQ ID NOs: 78-98; and an HC-CDR3 comprising the amino acid sequence of any one of SEQ ID NOs: 99-119, 244, and 245; and ii) a light chain variable domain sequence comprising an LC-CDR 1 comprising the amino acid sequence of any one of SEQ ID NOs: 120-140 and 246; an LC-CDR2 comprising the amino acid sequence of any one of SEQ ID NOs: 141-161 ; and an LC-CDR3 comprising the amino acid sequence of any one of SEQ ID NOs: 162-182 and 247-250; and b) a second antigen-binding moiety.
[0288] In some embodiments, there is provided a multi- specific anti-E7MC molecule comprising a) an anti-E7MC antibody moiety comprising a heavy chain variable domain comprising the amino acid sequence of any one of SEQ ID NOs: 15-35 and 233-237, or a variant thereof having at least about 95% (for example at least about any of 96%, 97%, 98%, or 99%) sequence identity, and a light chain variable domain comprising the amino acid sequence of any one of SEQ ID NOs: 36-56 and 238-243, or a variant thereof having at least about 95% (including for example at least about any of 96%, 97%, 98%, or 99%) sequence identity; and b) a second scFv.
[0289] In some embodiments, there is provided a multi- specific anti-E7MC molecule comprising a) an anti-E7MC antibody moiety comprising a heavy chain variable domain comprising the amino acid sequence of any one of SEQ ID NOs: 15-35 and 233-237 and a light chain variable domain comprising the amino acid sequence of any one of SEQ ID NOs: 36-56 and 238-243; and b) a second antigen-binding moiety.
[0290] In some embodiments, the multi- specific anti-E7MC molecule is, for example, a diabody (Db), a single-chain diabody (scDb), a tandem scDb (Tandab), a linear dimeric scDb
(LD-scDb), a circular dimeric scDb (CD-scDb), a di-diabody, a tandem scFv, a tandem di- scFv (e.g. , a bispecific T cell engager), a tandem tri-scFv, a tri(a)body, a bispecific Fab2, a di-miniantibody, a tetrabody, an scFv-Fc-scFv fusion, a dual-affinity retargeting (DART) antibody, a dual variable domain (DVD) antibody, an IgG-scFab, an scFab-ds-scFv, an Fv2-
Fc, an IgG-scFv fusion, a dock and lock (DNL) antibody, a knob-into-hole (KiH) antibody
(bispecific IgG prepared by the KiH technology), a DuoBody (bispecific IgG prepared by the Duobody technology), a heteromultimeric antibody, or a heteroconjugate antibody. In some embodiments, the multi- specific anti-E7MC molecule is a tandem scFv (e.g. , a tandem di- scFv, such as a bispecific T cell engager).
Tandem scFv
[0291] The multi- specific anti-E7MC molecule in some embodiments is a tandem scFv comprising a first scFv comprising an anti-E7MC antibody moiety and a second scFv (also referred to herein as a "tandem scFv multi- specific anti-E7MC antibody"). In some embodiments, the tandem scFv multi- specific anti-E7MC antibody further comprises at least one (such as at least about any of 2, 3, 4, 5, or more) additional scFv.
[0292] In some embodiments, there is provided a tandem scFv multi- specific (e.g. , bispecific) anti-E7MC antibody comprising a) a first scFv that specifically binds to a complex comprising an HPV16-E7 peptide and an MHC class I protein, and b) a second scFv. In some embodiments, the HPV16-E7 peptide is HPV16-E7 11-19 (SEQ ID NO: 4). In some embodiments, the MHC class I protein is HLA-A02. In some embodiments, the MHC class I protein is HLA-A*02:01. In some embodiments, the second scFv specifically binds to a complex comprising a different HPV16-E7 peptide bound to the MHC class I protein. In some embodiments, the second scFv specifically binds to a complex comprising the HPV16- E7 peptide bound to a different MHC class I protein. In some embodiments, the second scFv specifically binds to a different epitope on the complex comprising the HPV16-E7 peptide and the MHC class I protein. In some embodiments, the second scFv specifically binds to another antigen. In some embodiments, the second scFv specifically binds to an antigen on the surface of a cell, such as an E7MC-presenting cell. In some embodiments, the second scFv specifically binds to an antigen on the surface of a cell that does not express HPV16-E7. In some embodiments, the second scFv specifically binds to an antigen on the surface of a cytotoxic cell. In some embodiments, the second scFv specifically binds to an antigen on the surface of a lymphocyte, such as a T cell, an NK cell, a neutrophil, a monocyte, a
macrophage, or a dendritic cell. In some embodiments, the second scFv specifically binds to an antigen on the surface of an effector T cell, such as a cytotoxic T cell. In some
embodiments, the second scFv specifically binds to an antigen on the surface of an effector cell, including for example CD3y, CD35, CD3s, ΟΌ3ζ, CD28, CD16a, CD56, CD68, and GDS2D. In some embodiments, the first scFv is human, humanized, or semi-synthetic. In
some embodiments, the second scFv is human, humanized, or semi- synthetic. In some embodiments, both the first scFv and the second scFv are human, humanized, or semisynthetic. In some embodiments, the tandem scFv multi- specific anti-E7MC antibody further comprises at least one (such as at least about any of 2, 3, 4, 5, or more) additional scFv. In some embodiments, the anti-E7MC antibody moiety cross-reacts with at least one (such as at least any of 2, 3, 4, 5, or 6) complex comprising the MHC class I protein and a variant of the HPV16-E7 peptide having one amino acid substitution (such as a conservative amino acid substitution). In some embodiments, the anti-E7MC antibody moiety cross-reacts with at least one (such as at least any of 2, 3, 4, or 5) complex comprising the HPV16-E7 peptide and a different subtype of the MHC class I protein.
[0293] In some embodiments, there is provided a tandem scFv multi- specific (e.g. , bispecific) anti-E7MC antibody comprising a) a first scFv that specifically binds to a complex comprising an HPV16-E7 11- 19 peptide (SEQ ID NO: 4) and HLA-A*02:01, and b) a second scFv.
[0294] In some embodiments, there is provided a tandem scFv multi- specific (e.g. , bispecific) anti-E7MC antibody comprising a) a first scFv that specifically binds to a complex comprising an HPV16-E7 peptide and an MHC class I protein comprising i) a heavy chain variable domain sequence comprising an HC-CDR1 comprising the amino acid sequence of SEQ ID NO: 183, or a variant thereof comprising up to about 3 (for example about any of 1, 2, or 3) amino acid substitutions, an HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 184 or 185, or a variant thereof comprising up to about 3 (for example about any of 1, 2, or 3) amino acid substitutions, and an HC-CDR3 comprising the amino acid sequence of any one of SEQ ID NOs: 186-188, or a variant thereof comprising up to about 3 (for example about any of 1, 2, or 3) amino acid substitutions; and ii) a light chain variable domain comprising an LC-CDR1 comprising the amino acid sequence of SEQ ID NO: 189 or 190, or a variant thereof comprising up to about 3 (for example about any of 1, 2, or 3) amino acid substitutions, and an LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 191, or a variant thereof comprising up to about 3 (for example about any of 1, 2, or 3) amino acid substitutions, and b) a second scFv.
[0295] In some embodiments, there is provided a tandem scFv multi- specific (e.g. , bispecific) anti-E7MC antibody comprising a) a first scFv that specifically binds to a complex comprising an HPV16-E7 peptide and an MHC class I protein comprising i) a heavy chain variable domain sequence comprising an HC-CDR1 comprising the amino acid
sequence of SEQ ID NO: 183, an HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 184 or 185, and an HC-CDR3 comprising the amino acid sequence of any one of SEQ ID NOs: 186-188; and ii) a light chain variable domain comprising an LC-CDR1 comprising the amino acid sequence of SEQ ID NO: 189 or 190, and an LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 191, and b) a second scFv.
[0296] In some embodiments, there is provided a tandem scFv multi- specific (e.g. , bispecific) anti-E7MC antibody comprising a) a first scFv that specifically binds to a complex comprising an HPV16-E7 peptide and an MHC class I protein comprising i) a heavy chain variable domain comprising an HC-CDR1 comprising the amino acid sequence of any one of SEQ ID NOs: 57-77, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions, an HC-CDR2 comprising the amino acid sequence of any one of SEQ ID NOs: 78-98, or a variant thereof comprising up to about 5
(such as about any of 1, 2, 3, 4, or 5) amino acid substitutions, and an HC-CDR3 comprising the amino acid sequence of any one of SEQ ID NOs: 99- 119, 244, and 245, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid
substitutions; and ii) a light chain variable domain comprising an LC-CDR1 comprising the amino acid sequence of any one of SEQ ID NOs: 120-140 and 246, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions, an
LC-CDR2 comprising the amino acid sequence of any one of SEQ ID NOs: 141- 161, or a variant thereof comprising up to about 3 (such as about any of 1, 2, or 3) amino acid substitutions, and an LC-CDR3 comprising the amino acid sequence of any one of SEQ ID
NOs: 162-182 and 247-250, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions; and b) a second scFv.
[0297] In some embodiments, there is provided a tandem scFv multi- specific (e.g. , bispecific) anti-E7MC antibody comprising a) a first scFv that specifically binds to a complex comprising an HPV16-E7 peptide and an MHC class I protein comprising i) a heavy chain variable domain sequence comprising an HC-CDR1 comprising the amino acid sequence of any one of SEQ ID NOs: 57-77; an HC-CDR2 comprising the amino acid sequence of any one of SEQ ID NOs: 78-98; and an HC-CDR3 comprising the amino acid sequence of any one of SEQ ID NOs: 99- 119, 244, and 245; or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions in the HC-CDR sequences; and ii) a light chain variable domain sequence comprising an LC-CDR1 comprising the amino acid sequence of any one of SEQ ID NOs: 120-140 and 246; an LC-
CDR2 comprising the amino acid sequence of any one of SEQ ID NOs: 141-161 ; and an LC- CDR3 comprising the amino acid sequence of any one of SEQ ID NOs: 162-182 and 247- 250; or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions in the LC-CDR sequences; and b) a second scFv.
[0298] In some embodiments, there is provided a tandem scFv multi- specific (e.g. , bispecific) anti-E7MC antibody comprising a) a first scFv that specifically binds to a complex comprising an HPV16-E7 peptide and an MHC class I protein comprising i) a heavy chain variable domain sequence comprising an HC-CDR1 comprising the amino acid sequence of any one of SEQ ID NOs: 57-77; an HC-CDR2 comprising the amino acid sequence of any one of SEQ ID NOs: 78-98; and an HC-CDR3 comprising the amino acid sequence of any one of SEQ ID NOs: 99- 119, 244, and 245; and ii) a light chain variable domain sequence comprising an LC-CDR1 comprising the amino acid sequence of any one of SEQ ID NOs: 120-140 and 246; an LC-CDR2 comprising the amino acid sequence of any one of SEQ ID NOs: 141-161 ; and an LC-CDR3 comprising the amino acid sequence of any one of SEQ ID NOs: 162-182 and 247-250; and b) a second scFv.
[0299] In some embodiments, there is provided a tandem scFv multi- specific (e.g. , bispecific) anti-E7MC antibody comprising a) a first scFv comprising a heavy chain variable domain comprising the amino acid sequence of any one of SEQ ID NOs: 15-35 and 233-237, or a variant thereof having at least about 95% (for example at least about any of 96%, 97%, 98%, or 99%) sequence identity, and a light chain variable domain comprising the amino acid sequence of any one of SEQ ID NOs: 36-56 and 238-243, or a variant thereof having at least about 95% (including for example at least about any of 96%, 97%, 98%, or 99%) sequence identity; and b) a second scFv.
[0300] In some embodiments, there is provided a tandem scFv multi- specific (e.g. , bispecific) anti-E7MC antibody comprising a) a first scFv comprising a heavy chain variable domain comprising the amino acid sequence of any one of SEQ ID NOs: 15-35 and 233-237 and a light chain variable domain comprising the amino acid sequence of any one of SEQ ID NOs: 36-56 and 238-243; and b) a second scFv.
[0301] In some embodiments, there is provided a tandem scFv multi- specific (e.g. , bispecific) anti-E7MC antibody comprising a) a first scFv that specifically binds to a complex comprising an HPV16-E7 peptide and an MHC class I protein, and b) a second scFv, wherein the tandem scFv multi- specific anti-E7MC antibody is a tandem di-scFv or a tandem tri-scFv. In some embodiments, the tandem scFv multi- specific anti-E7MC antibody
is a tandem di-scFv. In some embodiments, the tandem scFv multi- specific anti-E7MC antibody is a bispecific T-cell engager.
[0302] For example, in some embodiments, there is provided a tandem di-scFv bispecific anti-E7MC antibody comprising a) a first scFv that specifically binds to a complex comprising an HPV16-E7 peptide and an MHC class I protein, and b) a second scFv that specifically binds to an antigen on the surface of a T cell. In some embodiments, the HPV16- E7 peptide is HPV16-E7 11-19 (SEQ ID NO: 4). In some embodiments, the MHC class I protein is HLA-A02. In some embodiments, the MHC class I protein is HLA-A*02:01. In some embodiments, the second scFv specifically binds to an antigen on the surface of an effector T cell, such as a cytotoxic T cell. In some embodiments, the second scFv specifically binds to an antigen selected, for example, from the group consisting of CD3y, CD35, CD3s, CD3C, CD28, OX40, GITR, CD137, CD27, CD40L, and HVEM. In some embodiments, the second scFv specifically binds to an agonistic epitope on an antigen on the surface of a T cell, wherein the binding of the second scFv to the antigen enhances T cell activation. In some embodiments, the first scFv is human, humanized, or semi- synthetic. In some embodiments, the second scFv is human, humanized, or semi-synthetic. In some embodiments, both the first scFv and the second scFv are human, humanized, or semi-synthetic.
[0303] In some embodiments, there is provided a tandem di-scFv bispecific anti-E7MC antibody comprising a) a first scFv that specifically binds to a complex comprising an HPV16-E7 11-19 peptide (SEQ ID NO: 4) and HLA-A*02:01, and b) a second scFv that specifically binds to an antigen on the surface of a T cell.
[0304] In some embodiments, there is provided a tandem di-scFv bispecific anti-E7MC antibody comprising a) a first scFv that specifically binds to a complex comprising an
HPV16-E7 peptide and an MHC class I protein comprising i) a heavy chain variable domain sequence comprising an HC-CDR1 comprising the amino acid sequence of SEQ ID NO: 183, or a variant thereof comprising up to about 3 (for example about any of 1, 2, or 3) amino acid substitutions, an HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 184 or 185, or a variant thereof comprising up to about 3 (for example about any of 1, 2, or 3) amino acid substitutions, and an HC-CDR3 comprising the amino acid sequence of any one of SEQ ID
NOs: 186-188, or a variant thereof comprising up to about 3 (for example about any of 1, 2, or 3) amino acid substitutions; and ii) a light chain variable domain comprising an LC-CDR1 comprising the amino acid sequence of SEQ ID NO: 189 or 190, or a variant thereof comprising up to about 3 (for example about any of 1, 2, or 3) amino acid substitutions, and
an LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 191, or a variant thereof comprising up to about 3 (for example about any of 1, 2, or 3) amino acid substitutions, and b) a second scFv that specifically binds to an antigen on the surface of a T cell.
[0305] In some embodiments, there is provided a tandem di-scFv bispecific anti-E7MC antibody comprising a) a first scFv that specifically binds to a complex comprising an
HPV16-E7 peptide and an MHC class I protein comprising i) a heavy chain variable domain sequence comprising an HC-CDRl comprising the amino acid sequence of SEQ ID NO: 183, an HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 184 or 185, and an HC-
CDR3 comprising the amino acid sequence of any one of SEQ ID NOs: 186-188; and ii) a light chain variable domain comprising an LC-CDR1 comprising the amino acid sequence of
SEQ ID NO: 189 or 190, and an LC-CDR3 comprising the amino acid sequence of SEQ ID
NO: 191, and b) a second scFv that specifically binds to an antigen on the surface of a T cell.
[0306] In some embodiments, there is provided a tandem di-scFv bispecific anti-E7MC antibody comprising a) a first scFv that specifically binds to a complex comprising an
HPV16-E7 peptide and an MHC class I protein comprising i) a heavy chain variable domain comprising an HC-CDRl comprising the amino acid sequence of any one of SEQ ID NOs:
57-77, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions, an HC-CDR2 comprising the amino acid sequence of any one of
SEQ ID NOs: 78-98, or a variant thereof comprising up to about 5 (such as about any of 1, 2,
3, 4, or 5) amino acid substitutions, and an HC-CDR3 comprising the amino acid sequence of any one of SEQ ID NOs: 99-119, 244, and 245, or a variant thereof comprising up to about 5
(such as about any of 1, 2, 3, 4, or 5) amino acid substitutions; and ii) a light chain variable domain comprising an LC-CDR1 comprising the amino acid sequence of any one of SEQ ID
NOs: 120-140 and 246, or a variant thereof comprising up to about 5 (such as about any of 1,
2, 3, 4, or 5) amino acid substitutions, an LC-CDR2 comprising the amino acid sequence of any one of SEQ ID NOs: 141-161, or a variant thereof comprising up to about 3 (such as about any of 1, 2, or 3) amino acid substitutions, and an LC-CDR3 comprising the amino acid sequence of any one of SEQ ID NOs: 162-182 and 247-250, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions; and b) a second scFv that specifically binds to an antigen on the surface of a T cell.
[0307] In some embodiments, there is provided a tandem di-scFv bispecific anti-E7MC antibody comprising a) a first scFv that specifically binds to a complex comprising an
HPV16-E7 peptide and an MHC class I protein comprising i) a heavy chain variable domain
sequence comprising an HC-CDR1 comprising the amino acid sequence of any one of SEQ ID NOs: 57-77; an HC-CDR2 comprising the amino acid sequence of any one of SEQ ID NOs: 78-98; and an HC-CDR3 comprising the amino acid sequence of any one of SEQ ID NOs: 99-119, 244, and 245; or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions in the HC-CDR sequences; and ii) a light chain variable domain sequence comprising an LC-CDR1 comprising the amino acid sequence of any one of SEQ ID NOs: 120-140 and 246; an LC-CDR2 comprising the amino acid sequence of any one of SEQ ID NOs: 141-161; and an LC-CDR3 comprising the amino acid sequence of any one of SEQ ID NOs: 162-182 and 247-250; or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions in the LC-CDR sequences, and b) a second scFv that specifically binds to an antigen on the surface of a T cell.
[0308] In some embodiments, there is provided a tandem di-scFv bispecific anti-E7MC antibody comprising a) a first scFv that specifically binds to a complex comprising an HPV16-E7 peptide and an MHC class I protein comprising i) a heavy chain variable domain sequence comprising an HC-CDR 1 comprising the amino acid sequence of any one of SEQ ID NOs: 57-77; an HC-CDR2 comprising the amino acid sequence of any one of SEQ ID NOs: 78-98; and an HC-CDR3 comprising the amino acid sequence of any one of SEQ ID NOs: 99-119, 244, and 245; and ii) a light chain variable domain sequence comprising an LC-CDR1 comprising the amino acid sequence of any one of SEQ ID NOs: 120-140 and 246; an LC-CDR2 comprising the amino acid sequence of any one of SEQ ID NOs: 141-161; and an LC-CDR3 comprising the amino acid sequence of any one of SEQ ID NOs: 162-182 and 247-250; and b) a second scFv that specifically binds to an antigen on the surface of a T cell.
[0309] In some embodiments, there is provided a tandem di-scFv bispecific anti-E7MC antibody comprising a) a first scFv comprising a heavy chain variable domain comprising the amino acid sequence of any one of SEQ ID NOs: 15-35 and 233-237, or a variant thereof having at least about 95% (for example at least about any of 96%, 97%, 98%, or 99%) sequence identity, and a light chain variable domain comprising the amino acid sequence of any one of SEQ ID NOs: 36-56 and 238-243, or a variant thereof having at least about 95% (for example at least about any of 96%, 97%, 98%, or 99%) sequence identity, and b) a second scFv that specifically binds to an antigen on the surface of a T cell.
[0310] In some embodiments, there is provided a tandem di-scFv bispecific anti-E7MC antibody comprising a) a first scFv comprising a heavy chain variable domain comprising the amino acid sequence of any one of SEQ ID NOs: 15-35 and 233-237 and a light chain variable domain comprising the amino acid sequence of any one of SEQ ID NOs: 36-56 and 238-243, and b) a second scFv that specifically binds to an antigen on the surface of a T cell.
[0311] In some embodiments, there is provided a tandem di-scFv bispecific anti-E7MC antibody comprising a) a first scFv that specifically binds to a complex comprising an HPV16-E7 peptide and an MHC class I protein, and b) a second scFv that specifically binds to CD3s. In some embodiments, the HPV16-E7 peptide is HPV16-E7 11-19 (SEQ ID NO: 4). In some embodiments, the MHC class I protein is HLA-A02. In some embodiments, the MHC class I protein is HLA-A*02:01. In some embodiments, the first scFv is fused to the second scFv through linkage with a peptide linker. In some embodiments, the peptide linker is between about 5 to about 20 (such as about any of 5, 10, 15, or 20, including any ranges between these values) amino acids in length. In some embodiments, the peptide linker comprises (and in some embodiments consists of) the amino acid sequence GGGGS. In some embodiments, the first scFv is human, humanized, or semi- synthetic. In some embodiments, the second scFv is human, humanized, or semi-synthetic. In some embodiments, both the first scFv and the second scFv are human, humanized, or semi-synthetic.
[0312] In some embodiments, there is provided a tandem di-scFv bispecific anti-E7MC antibody comprising a) a first scFv that specifically binds to a complex comprising an HPV16-E7 11-19 peptide (SEQ ID NO: 4) and HLA-A*02:01, and b) a second scFv that specifically binds to CD3s. In some embodiments, the first scFv is fused to the second scFv through linkage with a peptide linker. In some embodiments, the peptide linker is between about 5 to about 20 (such as about any of 5, 10, 15, or 20, including any ranges between these values) amino acids in length. In some embodiments, the peptide linker comprises (and in some embodiments consists of) the amino acid sequence GGGGS. In some embodiments, the first scFv is human, humanized, or semi-synthetic. In some embodiments, the second scFv is human, humanized, or semi- synthetic. In some embodiments, both the first scFv and the second scFv are human, humanized, or semi-synthetic.
[0313] In some embodiments, there is provided a tandem di-scFv bispecific anti-E7MC antibody comprising a) a first scFv that specifically binds to a complex comprising an
HPV16-E7 peptide and an MHC class I protein comprising i) a heavy chain variable domain sequence comprising an HC-CDRl comprising the amino acid sequence of SEQ ID NO: 183,
or a variant thereof comprising up to about 3 (for example about any of 1, 2, or 3) amino acid substitutions, an HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 184 or 185, or a variant thereof comprising up to about 3 (for example about any of 1, 2, or 3) amino acid substitutions, and an HC-CDR3 comprising the amino acid sequence of any one of SEQ ID NOs: 186-188, or a variant thereof comprising up to about 3 (for example about any of 1, 2, or 3) amino acid substitutions; and ii) a light chain variable domain comprising an LC-CDR1 comprising the amino acid sequence of SEQ ID NO: 189 or 190, or a variant thereof comprising up to about 3 (for example about any of 1, 2, or 3) amino acid substitutions, and an LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 191, or a variant thereof comprising up to about 3 (for example about any of 1, 2, or 3) amino acid substitutions, and b) a second scFv that specifically binds to CD3s. In some embodiments, the first scFv is fused to the second scFv through linkage with a peptide linker. In some embodiments, the peptide linker is between about 5 to about 20 (such as about any of 5, 10, 15, or 20, including any ranges between these values) amino acids in length. In some embodiments, the peptide linker comprises (and in some embodiments consists of) the amino acid sequence GGGGS. In some embodiments, the first scFv is human, humanized, or semi-synthetic. In some embodiments, the second scFv is human, humanized, or semi-synthetic. In some
embodiments, both the first scFv and the second scFv are human, humanized, or semisynthetic.
[0314] In some embodiments, there is provided a tandem di-scFv bispecific anti-E7MC antibody comprising a) a first scFv that specifically binds to a complex comprising an
HPV16-E7 peptide and an MHC class I protein comprising i) a heavy chain variable domain sequence comprising an HC-CDRl comprising the amino acid sequence of SEQ ID NO: 183, an HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 184 or 185, and an HC-
CDR3 comprising the amino acid sequence of any one of SEQ ID NOs: 186-188; and ii) a light chain variable domain comprising an LC-CDR1 comprising the amino acid sequence of
SEQ ID NO: 189 or 190, and an LC-CDR3 comprising the amino acid sequence of SEQ ID
NO: 191, and b) a second scFv that specifically binds to CD3s. In some embodiments, the first scFv is fused to the second scFv through linkage with a peptide linker. In some embodiments, the peptide linker is between about 5 to about 20 (such as about any of 5, 10,
15, or 20, including any ranges between these values) amino acids in length. In some embodiments, the peptide linker comprises (and in some embodiments consists of) the amino acid sequence GGGGS. In some embodiments, the first scFv is human, humanized, or semi-
synthetic. In some embodiments, the second scFv is human, humanized, or semi-synthetic. In some embodiments, both the first scFv and the second scFv are human, humanized, or semisynthetic.
[0315] In some embodiments, there is provided a tandem di-scFv bispecific anti-E7MC antibody comprising a) a first scFv that specifically binds to a complex comprising an
HPV16-E7 peptide and an MHC class I protein comprising i) a heavy chain variable domain comprising an HC-CDR1 comprising the amino acid sequence of any one of SEQ ID NOs:
57-77, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions, an HC-CDR2 comprising the amino acid sequence of any one of
SEQ ID NOs: 78-98, or a variant thereof comprising up to about 5 (such as about any of 1, 2,
3, 4, or 5) amino acid substitutions, and an HC-CDR3 comprising the amino acid sequence of any one of SEQ ID NOs: 99-119, 244, and 245, or a variant thereof comprising up to about 5
(such as about any of 1, 2, 3, 4, or 5) amino acid substitutions; and ii) a light chain variable domain comprising an LC-CDR1 comprising the amino acid sequence of any one of SEQ ID
NOs: 120-140 and 246, or a variant thereof comprising up to about 5 (such as about any of 1,
2, 3, 4, or 5) amino acid substitutions, an LC-CDR2 comprising the amino acid sequence of any one of SEQ ID NOs: 141-161, or a variant thereof comprising up to about 3 (such as about any of 1, 2, or 3) amino acid substitutions, and an LC-CDR3 comprising the amino acid sequence of any one of SEQ ID NOs: 162-182 and 247-250, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions, and b) a second scFv that specifically binds to CD3s. In some embodiments, the first scFv is fused to the second scFv through linkage with a peptide linker. In some embodiments, the peptide linker is between about 5 to about 20 (such as about any of 5, 10, 15, or 20, including any ranges between these values) amino acids in length. In some embodiments, the peptide linker comprises (and in some embodiments consists of) the amino acid sequence GGGGS. In some embodiments, the first scFv is human, humanized, or semi- synthetic. In some embodiments, the second scFv is human, humanized, or semi-synthetic. In some embodiments, both the first scFv and the second scFv are human, humanized, or semi-synthetic.
[0316] In some embodiments, there is provided a tandem di-scFv bispecific anti-E7MC antibody comprising a) a first scFv that specifically binds to a complex comprising an
HPV16-E7 peptide and an MHC class I protein comprising i) a heavy chain variable domain sequence comprising an HC-CDR1 comprising the amino acid sequence of any one of SEQ
ID NOs: 57-77; an HC-CDR2 comprising the amino acid sequence of any one of SEQ ID
NOs: 78-98; and an HC-CDR3 comprising the amino acid sequence of any one of SEQ ID NOs: 99-119, 244, and 245; or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions in the HC-CDR sequences; and ii) a light chain variable domain sequence comprising an LC-CDR1 comprising the amino acid sequence of any one of SEQ ID NOs: 120-140 and 246; an LC-CDR2 comprising the amino acid sequence of any one of SEQ ID NOs: 141-161; and an LC-CDR3 comprising the amino acid sequence of any one of SEQ ID NOs: 162-182 and 247-250; or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions in the LC-CDR sequences, and b) a second scFv that specifically binds to CD3s. In some embodiments, the first scFv is fused to the second scFv through linkage with a peptide linker. In some embodiments, the peptide linker is between about 5 to about 20 (such as about any of 5, 10, 15, or 20, including any ranges between these values) amino acids in length. In some embodiments, the peptide linker comprises (and in some embodiments consists of) the amino acid sequence GGGGS. In some embodiments, the first scFv is human, humanized, or semisynthetic. In some embodiments, the second scFv is human, humanized, or semi-synthetic. In some embodiments, both the first scFv and the second scFv are human, humanized, or semisynthetic.
[0317] In some embodiments, there is provided a tandem di-scFv bispecific anti-E7MC antibody comprising a) a first scFv that specifically binds to a complex comprising an
HPV16-E7 peptide and an MHC class I protein comprising i) a heavy chain variable domain sequence comprising an HC-CDR 1 comprising the amino acid sequence of any one of SEQ
ID NOs: 57-77; an HC-CDR2 comprising the amino acid sequence of any one of SEQ ID
NOs: 78-98; and an HC-CDR3 comprising the amino acid sequence of any one of SEQ ID
NOs: 99-119, 244, and 245; and ii) a light chain variable domain sequence comprising an
LC-CDR1 comprising the amino acid sequence of any one of SEQ ID NOs: 120-140 and
246; an LC-CDR2 comprising the amino acid sequence of any one of SEQ ID NOs: 141-161; and an LC-CDR3 comprising the amino acid sequence of any one of SEQ ID NOs: 162-182 and 247-250; and b) a second scFv that specifically binds to CD3s. In some embodiments, the first scFv is fused to the second scFv through linkage with a peptide linker. In some embodiments, the peptide linker is between about 5 to about 20 (such as about any of 5, 10,
15, or 20, including any ranges between these values) amino acids in length. In some embodiments, the peptide linker comprises (and in some embodiments consists of) the amino acid sequence GGGGS. In some embodiments, the first scFv is human, humanized, or semi-
synthetic. In some embodiments, the second scFv is human, humanized, or semi-synthetic. In some embodiments, both the first scFv and the second scFv are human, humanized, or semisynthetic.
[0318] In some embodiments, there is provided a tandem di-scFv bispecific anti-E7MC antibody comprising a) a first scFv comprising a heavy chain variable domain comprising the amino acid sequence of any one of SEQ ID NOs: 15-35 and 233-237, or a variant thereof having at least about 95% (for example at least about any of 96%, 97%, 98%, or 99%) sequence identity, and a light chain variable domain comprising the amino acid sequence of any one of SEQ ID NOs: 36-56 and 238-243, or a variant thereof having at least about 95% (for example at least about any of 96%, 97%, 98%, or 99%) sequence identity, and b) a second scFv that specifically binds to CD3s. In some embodiments, the first scFv is fused to the second scFv through linkage with a peptide linker. In some embodiments, the peptide linker is between about 5 to about 20 (such as about any of 5, 10, 15, or 20, including any ranges between these values) amino acids in length. In some embodiments, the peptide linker comprises (and in some embodiments consists of) the amino acid sequence GGGGS. In some embodiments, the first scFv is human, humanized, or semi- synthetic. In some embodiments, the second scFv is human, humanized, or semi-synthetic. In some embodiments, both the first scFv and the second scFv are human, humanized, or semi-synthetic.
[0319] In some embodiments, there is provided a tandem di-scFv bispecific anti-E7MC antibody comprising a) a first scFv comprising a heavy chain variable domain comprising the amino acid sequence of any one of SEQ ID NOs: 15-35 and 233-237 and a light chain variable domain comprising the amino acid sequence of any one of SEQ ID NOs: 36-56 and 238-243, and b) a second scFv that specifically binds to CD3s. In some embodiments, the first scFv is fused to the second scFv through linkage with a peptide linker. In some embodiments, the peptide linker is between about 5 to about 20 (such as about any of 5, 10, 15, or 20, including any ranges between these values) amino acids in length. In some embodiments, the peptide linker comprises (and in some embodiments consists of) the amino acid sequence GGGGS. In some embodiments, the first scFv is human, humanized, or semisynthetic. In some embodiments, the second scFv is human, humanized, or semi-synthetic. In some embodiments, both the first scFv and the second scFv are human, humanized, or semisynthetic.
[0320] In some embodiments, the tandem di-scFv bispecific anti-E7MC antibody binds to a complex comprising an HPV16-E7 peptide and an MHC class I protein with a Kd between
about 0.1 M to about 500 nM (such as about any of 0.1 pM, 1.0 pM, 10 pM, 50 pM, 100 pM, 500 pM, 1 nM, 10 nM, 50 nM, 100 nM, or 500 nM, including any ranges between these values). In some embodiments, the tandem di-scFv bispecific anti-E7MC antibody binds to a complex comprising an HPV16-E7 peptide and an MHC class I protein with a Kd between about 1 nM to about 500 nM (such as about any of 1, 10, 25, 50, 75, 100, 150, 200, 250, 300, 350, 400, 450, or 500 nM, including any ranges between these values).
Chimeric Antigen Receptor (CAR) and CAR effector cells
[0321] The anti-E7MC construct in some embodiments is a chimeric antigen receptor (CAR) comprising an anti-E7MC antibody moiety (also referred to herein as an "anti-E7MC CAR"). Also provided is a CAR effector cell (e.g. , T cell) comprising a CAR comprising an anti-E7MC antibody moiety (also referred to herein as an "anti-E7MC CAR effector cell", e.g. , "anti-E7MC CAR T cell").
[0322] The anti-E7MC CAR comprises a) an extracellular domain comprising an anti- E7MC antibody moiety that specifically binds to a complex comprising an HPV16-E7 peptide and an MHC class I protein and b) an intracellular signaling domain. A
transmembrane domain may be present between the extracellular domain and the intracellular domain.
[0323] Between the extracellular domain and the transmembrane domain of the anti-E7MC CAR, or between the intracellular domain and the transmembrane domain of the anti-E7MC CAR, there may be a spacer domain. The spacer domain can be any oligo- or polypeptide that functions to link the transmembrane domain to the extracellular domain or the intracellular domain in the polypeptide chain. A spacer domain may comprise up to about 300 amino acids, including for example about 10 to about 100, or about 25 to about 50 amino acids.
[0324] The transmembrane domain may be derived either from a natural or from a synthetic source. Where the source is natural, the domain may be derived from any membrane-bound or transmembrane protein. Transmembrane regions of particular use in this invention may be derived from (i.e. comprise at least the transmembrane region(s) of) the a, β, δ, γ, or ζ chain of the T-cell receptor, CD28, CD3s, ΟΌ3ζ, CD45, CD4, CD5, CD8, CD9, CD16, CD22, CD33, CD37, CD64, CD80, CD86, CD134, CD137, or CD154. In some embodiments, the transmembrane domain may be synthetic, in which case it may comprise predominantly hydrophobic residues such as leucine and valine. In some embodiments, a triplet of phenylalanine, tryptophan and valine may be found at each end of a synthetic
transmembrane domain. In some embodiments, a short oligo- or polypeptide linker, having a length of, for example, between about 2 and about 10 (such as about any of 2, 3, 4, 5, 6, 7, 8, 9, or 10) amino acids in length may form the linkage between the transmembrane domain and the intracellular signaling domain of the anti-E7MC CAR. In some embodiments, the linker is a glycine- serine doublet.
[0325] In some embodiments, the transmembrane domain that naturally is associated with one of the sequences in the intracellular domain of the anti-E7MC CAR is used (e.g. , if an anti-E7MC CAR intracellular domain comprises a CD28 co-stimulatory sequence, the transmembrane domain of the anti-E7MC CAR is derived from the CD28 transmembrane domain). In some embodiments, the transmembrane domain can be selected or modified by amino acid substitution to avoid binding of such domains to the transmembrane domains of the same or different surface membrane proteins to minimize interactions with other members of the receptor complex.
[0326] The intracellular signaling domain of the anti-E7MC CAR is responsible for activation of at least one of the normal effector functions of the immune cell in which the anti-E7MC CAR has been placed in. Effector function of a T cell, for example, may be cytolytic activity or helper activity including the secretion of cytokines. Thus the term
"intracellular signaling domain" refers to the portion of a protein which transduces the effector function signal and directs the cell to perform a specialized function. While usually the entire intracellular signaling domain can be employed, in many cases it is not necessary to use the entire chain. To the extent that a truncated portion of the intracellular signaling domain is used, such truncated portion may be used in place of the intact chain as long as it transduces the effector function signal. The term "intracellular signaling sequence" is thus meant to include any truncated portion of the intracellular signaling domain sufficient to transduce the effector function signal.
[0327] Examples of intracellular signaling domains for use in the anti-E7MC CAR of the invention include the cytoplasmic sequences of the T cell receptor (TCR) and co-receptors that act in concert to initiate signal transduction following antigen receptor engagement, as well as any derivative or variant of these sequences and any synthetic sequence that has the same functional capability.
[0328] It is known that signals generated through the TCR alone are insufficient for full activation of the T cell and that a secondary or co- stimulatory signal is also required. Thus, T cell activation can be said to be mediated by two distinct classes of intracellular signaling
sequence: those that initiate antigen-dependent primary activation through the TCR (primary signaling sequences) and those that act in an antigen-independent manner to provide a secondary or co-stimulatory signal (co-stimulatory signaling sequences).
[0329] Primary signaling sequences regulate primary activation of the TCR complex either in a stimulatory way, or in an inhibitory way. Primary signaling sequences that act in a stimulatory manner may contain signaling motifs which are known as immunoreceptor tyrosine-based activation motifs or ITAMs. The anti-E7MC CAR constructs in some embodiments comprise one or more ITAMs.
[0330] Examples of IT AM containing primary signaling sequences that are of particular use in the invention include those derived from TCRζ, FcRy, FcRp, CD3y, CD35, CD3s, CD5, CD22, CD79a, CD79b, and CD66d.
[0331] In some embodiments, the anti-E7MC CAR comprises a primary signaling sequence derived from CD3ζ. For example, the intracellular signaling domain of the CAR can comprise the CD3ζ intracellular signaling sequence by itself or combined with any other desired intracellular signaling sequence(s) useful in the context of the anti-E7MC CAR of the invention. For example, the intracellular domain of the anti-E7MC CAR can comprise a CD3ζ intracellular signaling sequence and a costimulatory signaling sequence. The costimulatory signaling sequence can be a portion of the intracellular domain of a
costimulatory molecule including, for example, CD27, CD28, 4-1BB (CD137), OX40, CD30, CD40, PD-1, ICOS, lymphocyte function-associated antigen-1 (LFA-1), CD2, CD7, LIGHT, NKG2C, B7-H3, a ligand that specifically binds with CD83, and the like.
[0332] In some embodiments, the intracellular signaling domain of the anti-E7MC CAR comprises the intracellular signaling sequence of CD3ζ and the intracellular signaling sequence of CD28. In some embodiments, the intracellular signaling domain of the anti- E7MC CAR comprises the intracellular signaling sequence of CD3ζ and the intracellular signaling sequence of 4- IBB. In some embodiments, the intracellular signaling domain of the anti-E7MC CAR comprises the intracellular signaling sequence of CD3ζ and the intracellular signaling sequences of CD28 and 4- IBB.
[0333] Thus, for example, in some embodiments, there is provided an anti-E7MC CAR comprising a) an extracellular domain comprising an anti-E7MC antibody moiety that specifically binds to a complex comprising an HPV16-E7 peptide and an MHC class I protein, b) a transmembrane domain, and c) an intracellular signaling domain. In some embodiments, the HPV16-E7 peptide is HPV16-E7 11-19 (SEQ ID NO: 4). In some
embodiments, the MHC class I protein is HLA-A02. In some embodiments, the MHC class I protein is HLA-A*02:01. In some embodiments, the intracellular signaling domain is capable of activating an immune cell. In some embodiments, the intracellular signaling domain comprises a primary signaling sequence and a co- stimulatory signaling sequence. In some embodiments, the primary signaling sequence comprises a CD3ζ intracellular signaling sequence. In some embodiments, the co- stimulatory signaling sequence comprises a CD28 intracellular signaling sequence. In some embodiments, the intracellular domain comprises a CD3ζ intracellular signaling sequence and a CD28 intracellular signaling sequence. In some embodiments, the anti-E7MC antibody moiety cross-reacts with at least one (such as at least any of 2, 3, 4, 5, or 6) complex comprising the MHC class I protein and a variant of the HPV16-E7 peptide having one amino acid substitution (such as a conservative amino acid substitution). In some embodiments, the anti-E7MC antibody moiety cross-reacts with at least one (such as at least any of 2, 3, 4, or 5) complex comprising the HPV16-E7 peptide and a different subtype of the MHC class I protein.
[0334] In some embodiments, there is provided an anti-E7MC CAR comprising a) an extracellular domain comprising an anti-E7MC antibody moiety that specifically binds to a complex comprising an HPV16-E7 11-19 peptide (SEQ ID NO: 4) and HLA-A*02:01, b) a transmembrane domain, and c) an intracellular signaling domain. In some embodiments, the intracellular signaling domain is capable of activating an immune cell. In some embodiments, the intracellular signaling domain comprises a primary signaling sequence and a co- stimulatory signaling sequence. In some embodiments, the primary signaling sequence comprises a CD3ζ intracellular signaling sequence. In some embodiments, the co-stimulatory signaling sequence comprises a CD28 intracellular signaling sequence. In some
embodiments, the intracellular domain comprises a CD3ζ intracellular signaling sequence and a CD28 intracellular signaling sequence.
[0335] In some embodiments, there is provided an anti-E7MC CAR comprising a) an extracellular domain comprising an anti-E7MC antibody moiety that specifically binds to a complex comprising an HPV16-E7 peptide and an MHC class I protein comprising i) a heavy chain variable domain sequence comprising an HC-CDR1 comprising the amino acid sequence of SEQ ID NO: 183, or a variant thereof comprising up to about 3 (for example about any of 1, 2, or 3) amino acid substitutions, an HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 184 or 185, or a variant thereof comprising up to about 3 (for example about any of 1, 2, or 3) amino acid substitutions, and an HC-CDR3 comprising the
amino acid sequence of any one of SEQ ID NOs: 186-188, or a variant thereof comprising up to about 3 (for example about any of 1, 2, or 3) amino acid substitutions; and ii) a light chain variable domain comprising an LC-CDR1 comprising the amino acid sequence of SEQ ID
NO: 189 or 190, or a variant thereof comprising up to about 3 (for example about any of 1, 2, or 3) amino acid substitutions, and an LC-CDR3 comprising the amino acid sequence of SEQ
ID NO: 191, or a variant thereof comprising up to about 3 (for example about any of 1, 2, or
3) amino acid substitutions, b) a transmembrane domain, and c) an intracellular signaling domain. In some embodiments, the intracellular signaling domain is capable of activating an immune cell. In some embodiments, the intracellular signaling domain comprises a primary signaling sequence and a co-stimulatory signaling sequence. In some embodiments, the primary signaling sequence comprises a CD3ζ intracellular signaling sequence. In some embodiments, the co-stimulatory signaling sequence comprises a CD28 intracellular signaling sequence. In some embodiments, the intracellular domain comprises a CD3ζ intracellular signaling sequence and a CD28 intracellular signaling sequence.
[0336] In some embodiments, there is provided an anti-E7MC CAR comprising a) an extracellular domain comprising an anti-E7MC antibody moiety that specifically binds to a complex comprising an HPV16-E7 peptide and an MHC class I protein comprising i) a heavy chain variable domain sequence comprising an HC-CDR1 comprising the amino acid sequence of SEQ ID NO: 183, an HC-CDR2 comprising the amino acid sequence of SEQ ID
NO: 184 or 185, and an HC-CDR3 comprising the amino acid sequence of any one of SEQ
ID NOs: 186-188; and ii) a light chain variable domain comprising an LC-CDR1 comprising the amino acid sequence of SEQ ID NO: 189 or 190, and an LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 191; b) an intracellular signaling domain. In some
embodiments, the intracellular signaling domain is capable of activating an immune cell. In some embodiments, the intracellular signaling domain comprises a primary signaling sequence and a co-stimulatory signaling sequence. In some embodiments, the primary signaling sequence comprises a CD3ζ intracellular signaling sequence. In some
embodiments, the co-stimulatory signaling sequence comprises a CD28 intracellular signaling sequence. In some embodiments, the intracellular domain comprises a CD3ζ intracellular signaling sequence and a CD28 intracellular signaling sequence.
[0337] In some embodiments, there is provided an anti-E7MC CAR comprising a) an extracellular domain comprising an anti-E7MC antibody moiety that specifically binds to a complex comprising an HPV16-E7 peptide and an MHC class I protein comprising i) a heavy
chain variable domain comprising an HC-CDR1 comprising the amino acid sequence of any one of SEQ ID NOs: 57-77, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions, an HC-CDR2 comprising the amino acid sequence of any one of SEQ ID NOs: 78-98, or a variant thereof comprising up to about 5
(such as about any of 1, 2, 3, 4, or 5) amino acid substitutions, and an HC-CDR3 comprising the amino acid sequence of any one of SEQ ID NOs: 99-119, 244, and 245, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid
substitutions; and ii) a light chain variable domain comprising an LC-CDR1 comprising the amino acid sequence of any one of SEQ ID NOs: 120-140 and 246, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions, an
LC-CDR2 comprising the amino acid sequence of any one of SEQ ID NOs: 141-161, or a variant thereof comprising up to about 3 (such as about any of 1, 2, or 3) amino acid substitutions, and an LC-CDR3 comprising the amino acid sequence of any one of SEQ ID
NOs: 162-182 and 247-250, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions; b) a transmembrane domain, and c) an intracellular signaling domain. In some embodiments, the intracellular signaling domain is capable of activating an immune cell. In some embodiments, the intracellular signaling domain comprises a primary signaling sequence and a co-stimulatory signaling sequence. In some embodiments, the primary signaling sequence comprises a CD3ζ intracellular signaling sequence. In some embodiments, the co- stimulatory signaling sequence comprises a CD28 intracellular signaling sequence. In some embodiments, the intracellular domain comprises a
CD3ζ intracellular signaling sequence and a CD28 intracellular signaling sequence.
[0338] In some embodiments, there is provided an anti-E7MC CAR comprising a) an extracellular domain comprising an anti-E7MC antibody moiety that specifically binds to a complex comprising an HPV16-E7 peptide and an MHC class I protein comprising i) a heavy chain variable domain sequence comprising an HC-CDR1 comprising the amino acid sequence of any one of SEQ ID NOs: 57-77; an HC-CDR2 comprising the amino acid sequence of any one of SEQ ID NOs: 78-98; and an HC-CDR3 comprising the amino acid sequence of any one of SEQ ID NOs: 99-119, 244, and 245; or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions in the HC-CDR sequences; and ii) a light chain variable domain sequence comprising an LC-CDR1 comprising the amino acid sequence of any one of SEQ ID NOs: 120-140 and 246; an LC-
CDR2 comprising the amino acid sequence of any one of SEQ ID NOs: 141-161; and an LC-
CDR3 comprising the amino acid sequence of any one of SEQ ID NOs: 162-182 and 247-
250; or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions in the LC-CDR sequences; b) a transmembrane domain, and c) an intracellular signaling domain. In some embodiments, the intracellular signaling domain is capable of activating an immune cell. In some embodiments, the intracellular signaling domain comprises a primary signaling sequence and a co-stimulatory signaling sequence. In some embodiments, the primary signaling sequence comprises a CD3ζ intracellular signaling sequence. In some embodiments, the co- stimulatory signaling sequence comprises a CD28 intracellular signaling sequence. In some embodiments, the intracellular domain comprises a
CD3ζ intracellular signaling sequence and a CD28 intracellular signaling sequence.
[0339] In some embodiments, there is provided an anti-E7MC CAR comprising a) an extracellular domain comprising an anti-E7MC antibody moiety that specifically binds to a complex comprising an HPV16-E7 peptide and an MHC class I protein comprising i) a heavy chain variable domain sequence comprising an HC-CDR1 comprising the amino acid sequence of any one of SEQ ID NOs: 57-77; an HC-CDR2 comprising the amino acid sequence of any one of SEQ ID NOs: 78-98; and an HC-CDR3 comprising the amino acid sequence of any one of SEQ ID NOs: 99-119, 244, and 245; and ii) a light chain variable domain sequence comprising an LC-CDR1 comprising the amino acid sequence of any one of SEQ ID NOs: 120-140 and 246; an LC-CDR2 comprising the amino acid sequence of any one of SEQ ID NOs: 141-161; and an LC-CDR3 comprising the amino acid sequence of any one of SEQ ID NOs: 162-182 and 247-250; b) an intracellular signaling domain. In some embodiments, the intracellular signaling domain is capable of activating an immune cell. In some embodiments, the intracellular signaling domain comprises a primary signaling sequence and a co-stimulatory signaling sequence. In some embodiments, the primary signaling sequence comprises a CD3ζ intracellular signaling sequence. In some
embodiments, the co-stimulatory signaling sequence comprises a CD28 intracellular signaling sequence. In some embodiments, the intracellular domain comprises a CD3ζ intracellular signaling sequence and a CD28 intracellular signaling sequence.
[0340] In some embodiments, there is provided an anti-E7MC CAR comprising a) an extracellular domain comprising an anti-E7MC antibody moiety that specifically binds to a complex comprising an HPV16-E7 peptide and an MHC class I protein comprising a heavy chain variable domain comprising the amino acid sequence of any one of SEQ ID NOs: 15-
35 and 233-237, or a variant thereof having at least about 95% (for example at least about any
of 96%, 97%, 98%, or 99%) sequence identity, and a light chain variable domain comprising the amino acid sequence of any one of SEQ ID NOs: 36-56 and 238-243, or a variant thereof having at least about 95% (including for example at least about any of 96%, 97%, 98%, or
99%) sequence identity; b) a transmembrane domain, and c) an intracellular signaling domain. In some embodiments, the intracellular signaling domain is capable of activating an immune cell. In some embodiments, the intracellular signaling domain comprises a primary signaling sequence and a co-stimulatory signaling sequence. In some embodiments, the primary signaling sequence comprises a CD3ζ intracellular signaling sequence. In some embodiments, the co-stimulatory signaling sequence comprises a CD28 intracellular signaling sequence. In some embodiments, the intracellular domain comprises a CD3ζ intracellular signaling sequence and a CD28 intracellular signaling sequence.
[0341] In some embodiments, there is provided an anti-E7MC CAR comprising a) an extracellular domain comprising an anti-E7MC antibody moiety that specifically binds to a complex comprising an HPV16-E7 peptide and an MHC class I protein comprising a heavy chain variable domain comprising the amino acid sequence of any one of SEQ ID NOs: 15-
35 and 233-237 and a light chain variable domain comprising the amino acid sequence of any one of SEQ ID NOs: 36-56 and 238-243; b) an intracellular signaling domain. In some embodiments, the intracellular signaling domain is capable of activating an immune cell. In some embodiments, the intracellular signaling domain comprises a primary signaling sequence and a co-stimulatory signaling sequence. In some embodiments, the primary signaling sequence comprises a CD3ζ intracellular signaling sequence. In some
embodiments, the co-stimulatory signaling sequence comprises a CD28 intracellular signaling sequence. In some embodiments, the intracellular domain comprises a CD3ζ intracellular signaling sequence and a CD28 intracellular signaling sequence.
[0342] In some embodiments, there is provided an anti-E7MC CAR comprising a) an extracellular domain comprising an anti-E7MC antibody moiety that specifically binds to a complex comprising an HPV16-E7 peptide and an MHC class I protein, b) a transmembrane domain, and c) an intracellular signaling domain comprising a CD3ζ intracellular signaling sequence and a CD28 intracellular signaling sequence. In some embodiments, the HPV16-E7 peptide is HPV16-E7 11-19 (SEQ ID NO: 4). In some embodiments, the MHC class I protein is HLA-A02. In some embodiments, the MHC class I protein is HLA-A*02:01.
[0343] In some embodiments, there is provided an anti-E7MC CAR comprising a) an extracellular domain comprising an anti-E7MC antibody moiety that specifically binds to a
complex comprising an HPV16-E7 11-19 peptide (SEQ ID NO: 4) and HLA-A*02:01, b) a transmembrane domain, and c) an intracellular signaling domain comprising a CD3ζ intracellular signaling sequence and a CD28 intracellular signaling sequence.
[0344] In some embodiments, there is provided an anti-E7MC CAR comprising a) an extracellular domain comprising an anti-E7MC antibody moiety that specifically binds to a complex comprising an HPV16-E7 peptide and an MHC class I protein comprising i) a heavy chain variable domain sequence comprising an HC-CDR1 comprising the amino acid sequence of SEQ ID NO: 183, or a variant thereof comprising up to about 3 (for example about any of 1, 2, or 3) amino acid substitutions, an HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 184 or 185, or a variant thereof comprising up to about 3 (for example about any of 1, 2, or 3) amino acid substitutions, and an HC-CDR3 comprising the amino acid sequence of any one of SEQ ID NOs: 186-188, or a variant thereof comprising up to about 3 (for example about any of 1, 2, or 3) amino acid substitutions; and ii) a light chain variable domain comprising an LC-CDR1 comprising the amino acid sequence of SEQ ID NO: 189 or 190, or a variant thereof comprising up to about 3 (for example about any of 1, 2, or 3) amino acid substitutions, and an LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 191, or a variant thereof comprising up to about 3 (for example about any of 1, 2, or 3) amino acid substitutions, b) a transmembrane domain, and c) an intracellular signaling domain comprising a CD3ζ intracellular signaling sequence and a CD28 intracellular signaling sequence.
[0345] In some embodiments, there is provided an anti-E7MC CAR comprising a) an extracellular domain comprising an anti-E7MC antibody moiety that specifically binds to a complex comprising an HPV16-E7 peptide and an MHC class I protein comprising i) a heavy chain variable domain sequence comprising an HC-CDR1 comprising the amino acid sequence of SEQ ID NO: 183, an HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 184 or 185, and an HC-CDR3 comprising the amino acid sequence of any one of SEQ ID NOs: 186-188; and ii) a light chain variable domain comprising an LC-CDR1 comprising the amino acid sequence of SEQ ID NO: 189 or 190, and an LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 191, b) a transmembrane domain, and c) an intracellular signaling domain comprising a CD3ζ intracellular signaling sequence and a CD28 intracellular signaling sequence.
[0346] In some embodiments, there is provided an anti-E7MC CAR comprising a) an extracellular domain comprising an anti-E7MC antibody moiety that specifically binds to a
complex comprising an HPV16-E7 peptide and an MHC class I protein comprising i) a heavy chain variable domain comprising an HC-CDR1 comprising the amino acid sequence of any one of SEQ ID NOs: 57-77, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions, an HC-CDR2 comprising the amino acid sequence of any one of SEQ ID NOs: 78-98, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions, and an HC-CDR3 comprising the amino acid sequence of any one of SEQ ID NOs: 99-119, 244, and 245, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid
substitutions; and ii) a light chain variable domain comprising an LC-CDR1 comprising the amino acid sequence of any one of SEQ ID NOs: 120-140 and 246, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions, an LC-CDR2 comprising the amino acid sequence of any one of SEQ ID NOs: 141-161, or a variant thereof comprising up to about 3 (such as about any of 1, 2, or 3) amino acid substitutions, and an LC-CDR3 comprising the amino acid sequence of any one of SEQ ID NOs: 162-182 and 247-250, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions; b) a transmembrane domain, and c) an intracellular signaling domain comprising a CD3ζ intracellular signaling sequence and a CD28 intracellular signaling sequence.
[0347] In some embodiments, there is provided an anti-E7MC CAR comprising a) an extracellular domain comprising an anti-E7MC antibody moiety that specifically binds to a complex comprising an HPV16-E7 peptide and an MHC class I protein comprising i) a heavy chain variable domain sequence comprising an HC-CDR1 comprising the amino acid sequence of any one of SEQ ID NOs: 57-77; an HC-CDR2 comprising the amino acid sequence of any one of SEQ ID NOs: 78-98; and an HC-CDR3 comprising the amino acid sequence of any one of SEQ ID NOs: 99-119, 244, and 245; or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions in the HC-CDR sequences; and ii) a light chain variable domain sequence comprising an LC-CDR1 comprising the amino acid sequence of any one of SEQ ID NOs: 120-140 and 246; an LC- CDR2 comprising the amino acid sequence of any one of SEQ ID NOs: 141-161; and an LC- CDR3 comprising the amino acid sequence of any one of SEQ ID NOs: 162-182 and 247- 250; or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions in the LC-CDR sequences; b) a transmembrane domain, and c) an
intracellular signaling domain comprising a CD3ζ intracellular signaling sequence and a CD28 intracellular signaling sequence.
[0348] In some embodiments, there is provided an anti-E7MC CAR comprising a) an extracellular domain comprising an anti-E7MC antibody moiety that specifically binds to a complex comprising an HPV16-E7 peptide and an MHC class I protein comprising i) a heavy chain variable domain sequence comprising an HC-CDR1 comprising the amino acid sequence of any one of SEQ ID NOs: 57-77; an HC-CDR2 comprising the amino acid sequence of any one of SEQ ID NOs: 78-98; and an HC-CDR3 comprising the amino acid sequence of any one of SEQ ID NOs: 99-119, 244, and 245; and ii) a light chain variable domain sequence comprising an LC-CDR1 comprising the amino acid sequence of any one of SEQ ID NOs: 120-140 and 246; an LC-CDR2 comprising the amino acid sequence of any one of SEQ ID NOs: 141-161; and an LC-CDR3 comprising the amino acid sequence of any one of SEQ ID NOs: 162-182 and 247-250; b) a transmembrane domain, and c) an intracellular signaling domain comprising a CD3ζ intracellular signaling sequence and a CD28 intracellular signaling sequence.
[0349] In some embodiments, there is provided an anti-E7MC CAR comprising a) an extracellular domain comprising an anti-E7MC antibody moiety that specifically binds to a complex comprising an HPV16-E7 peptide and an MHC class I protein comprising i) a heavy chain variable domain comprising the amino acid sequence of any one of SEQ ID NOs: 15- 35 and 233-237, or a variant thereof having at least about 95% (for example at least about any of 96%, 97%, 98%, or 99%) sequence identity, and a light chain variable domain comprising the amino acid sequence of any one of SEQ ID NOs: 36-56 and 238-243, or a variant thereof having at least about 95% (including for example at least about any of 96%, 97%, 98%, or 99%) sequence identity; b) a transmembrane domain, and c) an intracellular signaling domain comprising a CD3ζ intracellular signaling sequence and a CD28 intracellular signaling sequence.
[0350] In some embodiments, there is provided an anti-E7MC CAR comprising a) an extracellular domain comprising an anti-E7MC antibody moiety that specifically binds to a complex comprising an HPV16-E7 peptide and an MHC class I protein comprising a heavy chain variable domain comprising the amino acid sequence of any one of SEQ ID NOs: 15- 35 and 233-237 and a light chain variable domain comprising the amino acid sequence of any one of SEQ ID NOs: 36-56 and 238-243; b) a transmembrane domain, and c) an intracellular
signaling domain comprising a CD3ζ intracellular signaling sequence and a CD28
intracellular signaling sequence.
[0351] Also provided herein are effector cells (such as lymphocytes, e.g., T cells) expressing an anti-E7MC CAR.
[0352] Also provided is a method of producing an effector cell expressing an anti-E7MC CAR, the method comprising introducing a vector comprising a nucleic acid encoding the anti-E7MC CAR into the effector cell. In some embodiments, introducing the vector into the effector cell comprises transducing the effector cell with the vector. In some embodiments, introducing the vector into the effector cell comprises transfecting the effector cell with the vector. Transduction or transfection of the vector into the effector cell can be carried about using any method known in the art.
Immunoconjugates
[0353] The anti-E7MC constructs in some embodiments comprise an immunoconjugate comprising an anti-E7MC antibody moiety attached to an effector molecule (also referred to herein as an "anti-E7MC immunoconjugate"). In some embodiments the effector molecule is a therapeutic agent, such as a cancer therapeutic agent, which is either cytotoxic, cytostatic or otherwise provides some therapeutic benefit. In some embodiments, the effector molecule is a label, which can generate a detectable signal, either directly or indirectly.
[0354] In some embodiments, there is provided an anti-E7MC immunoconjugate comprising an anti-E7MC antibody moiety and a therapeutic agent (also referred to herein as an "antibody-drug conjugate", or "ADC"). In some embodiments, the therapeutic agent is a toxin that is either cytotoxic, cytostatic or otherwise prevents or reduces the ability of the target cells to divide. The use of ADCs for the local delivery of cytotoxic or cytostatic agents, i.e., drugs to kill or inhibit tumor cells in the treatment of cancer (Syrigos and Epenetos, Anticancer Research 19:605-614 (1999); Niculescu-Duvaz and Springer, Adv. Org. Del. Rev. 26: 151 -172 (1997); U.S. Patent No. 4,975,278) allows targeted delivery of the drug moiety to target cells, and intracellular accumulation therein, where systemic administration of these unconjugated therapeutic agents may result in unacceptable levels of toxicity to normal cells as well as the target cells sought to be eliminated (Baldwin et ah, Lancet (Mar. 15,
1986):603-605 (1986); Thorpe, (1985) "Antibody Carriers Of Cytotoxic Agents In Cancer Therapy: A Review," in Monoclonal Antibodies '84: Biological And Clinical Applications, A. Pinchera et al. (eds.), pp. 475- 506). Maximal efficacy with minimal toxicity is sought
thereby. Importantly, since most normal cells do not present the E7MC on their surface, they cannot bind the anti-E7MC immunoconjugate, and are protected from the killing effect of the toxin or other therapeutic agents.
[0355] Therapeutic agents used in anti-E7MC immunoconjugates include, for example, daunomycin, doxorubicin, methotrexate, and vindesine (Rowland et al. , Cancer Immunol. Immunother. 21: 183-187 (1986)). Toxins used in anti-E7MC immunoconjugates include bacterial toxins such as diphtheria toxin, plant toxins such as ricin, small molecule toxins such as geldanamycin (Mandler et al, J.Nat. Cancer Inst. 92(19): 1573-1581 (2000); Mandler et al., Bioorganic & Med. Chem. Letters 10: 1025- 1028 (2000); Mandler et al., Bioconjugate Chem. 13:786-791 (2002)), maytansinoids (EP 1391213; Liu et al., Proc. Natl. Acad. Sci. USA 93:8618-8623 (1996)), and calicheamicin (Lode et al., Cancer Res. 58:2928 (1998); Hinman et al., Cancer Res. 53:3336-3342 (1993)). The toxins may exert their cytotoxic and cytostatic effects by mechanisms including tubulin binding, DNA binding, or topoisomerase inhibition. Some cytotoxic drugs tend to be inactive or less active when conjugated to large antibodies or protein receptor ligands.
[0356] Enzymatically active toxins and fragments thereof that can be used include, for example, diphtheria A chain, nonbinding active fragments of diphtheria toxin, exotoxin A chain (from Pseudomonas aeruginosa), ricin A chain, abrin A chain, modeccin A chain,a- sarcin, Aleurites fordii proteins, dianthin proteins, Phytolaca americana proteins (PAPI, PAPII, and PAP-S), momordica charantia inhibitor, curcin, crotin, sapaonaria officinalis inhibitor, gelonin, mitogellin, restrictocin, phenomycin, enomycin, and the tricothecenes. See, e.g., WO 93/21232 published October 28, 1993.
[0357] Anti-E7MC immunoconjugates of an anti-E7MC antibody moiety and one or more small molecule toxins, such as a calicheamicin, maytansinoids, dolastatins, aurostatins, a trichothecene, and CC1065, and the derivatives of these toxins that have toxin activity, are also contemplated herein.
[0358] In some embodiments, there is provided an anti-E7MC immunoconjugate comprising a therapeutic agent that has an intracellular activity. In some embodiments, the anti-E7MC immunoconjugate is internalized and the therapeutic agent is a cytotoxin that blocks the protein synthesis of the cell, therein leading to cell death. In some embodiments, the therapeutic agent is a cytotoxin comprising a polypeptide having ribosome-inactivating activity including, for example, gelonin, bouganin, saporin, ricin, ricin A chain, bryodin, diphtheria toxin, restrictocin, Pseudomonas exotoxin A and variants thereof. In some
embodiments, where the therapeutic agent is a cytotoxin comprising a polypeptide having a ribosome-inactivating activity, the anti-E7MC immunoconjugate must be internalized upon binding to the target cell in order for the protein to be cytotoxic to the cells.
[0359] In some embodiments, there is provided an anti-E7MC immunoconjugate comprising a therapeutic agent that acts to disrupt DNA. In some embodiments, the therapeutic agent that acts to disrupt DNA is, for example, selected from the group consisting of enediyne (e.g. , calicheamicin and esperamicin) and non-enediyne small molecule agents (e.g. , bleomycin, methidiumpropyl-EDTA-Fe(II)). Other cancer therapeutic agents useful in accordance with the present application include, without limitation, daunorubicin, doxorubicin, distamycin A, cisplatin, mitomycin C, ecteinascidins, duocarmycin/CC-1065, and bleomycin/pepleomycin.
[0360] The present invention further contemplates an anti-E7MC immunoconjugate formed between the anti-E7MC antibody moiety and a compound with nucleolytic activity (e.g. , a ribonuclease or a DNA endonuclease such as a deoxyribonuclease; DNase).
[0361] In some embodiments, the anti-E7MC immunoconjugate comprises an agent that acts to disrupt tubulin. Such agents may include, for example, rhizoxin/maytansine, paclitaxel, vincristine and vinblastine, colchicine, auristatin dolastatin 10 MMAE, and peloruside A.
[0362] In some embodiments, the anti-E7MC immunoconjugate comprises an alkylating agent including, for example, Asaley NSC 167780, AZQ NSC 182986, BCNU NSC 409962,
Busulfan NSC 750, carboxyphthalatoplatinum NSC 271674, CBDCA NSC 241240, CCNU
NSC 79037, CHIP NSC 256927, chlorambucil NSC 3088, chlorozotocin NSC 178248, cis- platinum NSC 119875, clomesone NSC 338947, cyanomorpholinodoxorubicin NSC 357704, cyclodisone NSC 348948, dianhydrogalactitol NSC 132313, fluorodopan NSC 73754, hepsulfam NSC 329680, hycanthone NSC 142982, melphalan NSC 8806, methyl CCNU
NSC 95441 , mitomycin C NSC 26980, mitozolamide NSC 353451 , nitrogen mustard NSC
762, PCNU NSC 95466, piperazine NSC 344007, piperazinedione NSC 135758, pipobroman
NSC 25154, porfiromycin NSC 56410, spirohydantoin mustard NSC 172112, teroxirone
NSC 296934, tetraplatin NSC 363812, thio-tepa NSC 6396, triethylenemelamine NSC 9706, uracil nitrogen mustard NSC 34462, and Yoshi-864 NSC 102627.
[0363] In some embodiments, the cancer therapeutic agent portion of the anti-E7MC immunoconjugate of the present application may comprise an antimitotic agent including, without limitation, allocolchicine NSC 406042, Halichondrin B NSC 609395, colchicine
NSC 757, colchicine derivative NSC 33410, dolastatin 10 NSC 376128 (NG - auristatin derived), maytansine NSC 153858, rhizoxin NSC 332598, taxol NSC 125973, taxol derivative NSC 608832, thiocolchicine NSC 361792, trityl cysteine NSC 83265, vinblastine sulfate NSC 49842, and vincristine sulfate NSC 67574.
[0364] In some embodiments, the anti-E7MC immunoconjugate comprises a topoisomerase
I inhibitor including, without limitation, camptothecin NSC 94600, camptothecin, Na salt NSC 100880, aminocamptothecin NSC 603071 , camptothecin derivative NSC 95382, camptothecin derivative NSC 107124, camptothecin derivative NSC 643833, camptothecin derivative NSC 629971 , camptothecin derivative NSC 295500, camptothecin derivative NSC 249910, camptothecin derivative NSC 606985, camptothecin derivative NSC 374028, camptothecin derivative NSC 176323, camptothecin derivative NSC 295501 , camptothecin derivative NSC 606172, camptothecin derivative NSC 606173, camptothecin derivative NSC 610458, camptothecin derivative NSC 618939, camptothecin derivative NSC 610457, camptothecin derivative NSC 610459, camptothecin derivative NSC 606499, camptothecin derivative NSC 610456, camptothecin derivative NSC 364830, camptothecin derivative NSC 606497, and morpholinodoxorubicin NSC 354646.
[0365] In some embodiments, the anti-E7MC immunoconjugate comprises a topoisomerase
II inhibitor including, without limitation, doxorubicin NSC 123127, amonafide NSC 308847, m-AMSA NSC 249992, anthrapyrazole derivative NSC 355644, pyrazoloacridine NSC 366140, bisantrene HCL NSC 337766, daunorubicin NSC 82151 , deoxydoxorubicin NSC 267469, mitoxantrone NSC 301739, menogaril NSC 269148, Ν,Ν-dibenzyl daunomycin NSC 268242, oxanthrazole NSC 349174, rubidazone NSC 164011 , VM-26 NSC 122819, and VP-16 NSC 141540.
[0366] In some embodiments, the anti-E7MC immunoconjugate comprises an RNA or
DNA antimetabolite including, without limitation, L-alanosine NSC 153353, 5-azacytidine
NSC 102816, 5-fluorouracil NSC 19893, acivicin NSC 163501 , aminopterin derivative NSC
132483, aminopterin derivative NSC 184692, aminopterin derivative NSC 134033, an antifol
NSC 633713, an antifol NSC 623017, Baker's soluble antifol NSC 139105, dichlorallyl lawsone NSC 126771 , brequinar NSC 368390, ftorafur (pro-drug) NSC 148958, 5,6- dihydro-5-azacytidine NSC 264880, methotrexate NSC 740, methotrexate derivative NSC
174121 , N-(phosphonoacetyl)-L-aspartate (PALA) NSC 224131 , pyrazofurin NSC 143095, trimetrexate NSC 352122, 3-HP NSC 95678, 2'-deoxy-5-fluorouridine NSC 27640, 5-HP
NSC 107392,a-TGDR NSC 71851 , aphidicolin glycinate NSC 303812, ara-C NSC 63878, 5-
aza-2'- deoxycytidine NSC 127716,p-TGDR NSC 71261 , cyclocytidine NSC 145668, guanazole NSC 1895, hydroxyurea NSC 32065, inosine glycodialdehyde NSC 118994, macbecin II NSC 330500, pyrazoloimidazole NSC 51143, thioguanine NSC 752, and thiopurine NSC 755.
[0367] In some embodiments, the anti-E7MC immunoconjugate comprises a highly radioactive atom. A variety of radioactive isotopes are available for the production of radioconjugated antibodies. Examples include 211At, 131I, 125I, 90Y, 186Re, 188Re, 153Sm, 212Bi,
32 212
P, Pb and radioactive isotopes of Lu.
[0368] In some embodiments, the anti-E7MC antibody moiety can be conjugated to a "receptor" (such as streptavidin) for utilization in tumor pre-targeting wherein the antibody- receptor conjugate is administered to the patient, followed by removal of unbound conjugate from the circulation using a clearing agent and then administration of a "ligand" (e.g., avidin) that is conjugated to a cytotoxic agent (e.g., a radionucleotide).
[0369] In some embodiments, an anti-E7MC immunoconjugate may comprise an anti- E7MC antibody moiety conjugated to a prodrug-activating enzyme. In some such
embodiments, a prodrug-activating enzyme converts a prodrug (e.g. , a peptidyl
chemotherapeutic agent, see WO 81/01145) to an active drug, such as an anti-cancer drug. Such anti-E7MC immunoconjugates are useful, in some embodiments, in antibody-dependent enzyme-mediated prodrug therapy ("ADEPT"). Enzymes that may be conjugated to an antibody include, but are not limited to, alkaline phosphatases, which are useful for converting phosphate-containing prodrugs into free drugs; arylsulfatases, which are useful for converting sulfate-containing prodrugs into free drugs; cytosine deaminase, which is useful for converting non-toxic 5-fluorocytosine into the anti-cancer drug, 5-fluorouracil; proteases, such as serratia protease, thermolysin, subtilisin, carboxypeptidases and cathepsins (such as cathepsins B and L), which are useful for converting peptide-containing prodrugs into free drugs; D-alanylcarboxypeptidases, which are useful for converting prodrugs that contain D- amino acid substituents; carbohydrate-cleaving enzymes such as β-galactosidase and neuraminidase, which are useful for converting glycosylated prodrugs into free drugs; β- lactamase, which is useful for converting drugs derivatized with β -lactams into free drugs; and penicillin amidases, such as penicillin V amidase and penicillin G amidase, which are useful for converting drugs derivatized at their amine nitrogens with phenoxyacetyl or phenylacetyl groups, respectively, into free drugs. In some embodiments, enzymes may be
covalently bound to antibody moieties by recombinant DNA techniques well known in the art. See, e.g., Neuberger et al, Nature 312:604-608 (1984).
[0370] In some embodiments, the therapeutic portion of the anti-E7MC immunoconjugates may be a nucleic acid. Nucleic acids that may be used include, but are not limited to, anti- sense RNA, genes or other polynucleotides, including nucleic acid analogs such as thioguanine and thiopurine.
[0371] The present application further provides anti-E7MC immunoconjugates comprising an anti-E7MC antibody moiety attached to an effector molecule, wherein the effector molecule is a label, which can generate a detectable signal, indirectly or directly. These anti- E7MC immunoconjugates can be used for research or diagnostic applications, such as for the in vivo detection of cancer. The label is preferably capable of producing, either directly or indirectly, a detectable signal. For example, the label may be radio-opaque or a radioisotope, such as 3 H, 14 C, 32 P, 35 S, 123 I, 125 I, 131 I; a fluorescent (fluorophore) or chemiluminescent (chromophore) compound, such as fluorescein isothiocyanate, rhodamine or luciferin; an enzyme, such as alkaline phosphatase,P-galactosidase or horseradish peroxidase; an imaging agent; or a metal ion. In some embodiments, the label is a radioactive atom for scintigraphic studies, for example 99 Tc or 123 I, or a spin label for nuclear magnetic resonance (NMR) imaging (also known as magnetic resonance imaging, MRI), such as zirconium-89, iodine-
123, iodine-131, indium-I l l, fluorine-19, carbon-13, nitrogen-15, oxygen-17, gadolinium, manganese or iron. Zirconium-89 may be complexed to various metal chelating agents and conjugated to antibodies, e.g., for PET imaging (WO 2011/056983).
[0372] In some embodiments, the anti-E7MC immunoconjugate is detectable indirectly.
For example, a secondary antibody that is specific for the anti-E7MC immunoconjugate and contains a detectable label can be used to detect the anti-E7MC immunoconjugate.
[0373] Thus, for example, in some embodiments, there is provided an anti-E7MC immunoconjugate comprising a) an anti-E7MC antibody moiety that specifically binds to a complex comprising an HPV16-E7 peptide and an MHC class I protein, and b) an effector molecule. In some embodiments, the HPV16-E7 peptide is HPV16-E7 11-19 (SEQ ID NO:
4). In some embodiments, the MHC class I protein is HLA-A02. In some embodiments, the
MHC class I protein is HLA-A*02:01. In some embodiments, the effector molecule is covalently attached to the anti-E7MC antibody moiety. In some embodiments, the effector molecule is a therapeutic agent selected, for example, from the group consisting of a drug, a toxin, a radioisotope, a protein, a peptide, and a nucleic acid. In some embodiments, the
effector molecular is a cancer therapeutic agent. In some embodiments, the cancer therapeutic agent is a chemotherapeutic. In some embodiments, the cancer therapeutic agent is a highly radioactive atom selected, for example, from the group consisting of 211 At, 131I, 125I, 90Y, 186Re, 188Re, 153Sm, 212Bi, 32P, and 212Pb. In some embodiments, the effector molecule is a label that can generate a detectable signal, either directly or indirectly. In some embodiments, the label is a radioisotope selected, for example, from the group consisting of 3 H, 14 C, 32 P,
3 J5JS, and 131 In some embodiments, the anti-E7MC antibody moiety is an scFv. In some embodiments, the anti-E7MC antibody moiety is human, humanized, or semi- synthetic. In some embodiments, the anti-E7MC antibody moiety cross-reacts with at least one (such as at least any of 2, 3, 4, 5, or 6) complex comprising the MHC class I protein and a variant of the HPV16-E7 peptide having one amino acid substitution (such as a conservative amino acid substitution). In some embodiments, the anti-E7MC antibody moiety cross-reacts with at least one (such as at least any of 2, 3, 4, or 5) complex comprising the HPV16-E7 peptide and a different subtype of the MHC class I protein.
[0374] In some embodiments, there is provided an anti-E7MC immunoconjugate comprising a) an anti-E7MC antibody moiety that specifically binds to a complex comprising an HPV16-E7 11-19 peptide (SEQ ID NO: 4) and HLA-A*02:01, and b) an effector molecule. In some embodiments, the effector molecule is covalently attached to the anti- E7MC antibody moiety. In some embodiments, the effector molecule is a therapeutic agent selected, for example, from the group consisting of a drug, a toxin, a radioisotope, a protein, a peptide, and a nucleic acid. In some embodiments, the effector molecular is a cancer therapeutic agent. In some embodiments, the cancer therapeutic agent is a chemotherapeutic. In some embodiments, the cancer therapeutic agent is a highly radioactive atom selected, for example, from the group consisting of 211At, 131I, 125I, 90Y, 186Re, 188Re, 153Sm, 212Bi, 32P, and
212 Pb. In some embodiments, the effector molecule is a label that can generate a detectable signal, either directly or indirectly. In some embodiments, the label is a radioisotope selected, for example, from the group consisting of 3 H, 14 C, 32 P, 35 S, 123 I, 125 I, and 131 I. In some embodiments, the anti-E7MC antibody moiety is an scFv. In some embodiments, the anti-
E7MC antibody moiety is human, humanized, or semi- synthetic.
[0375] In some embodiments, there is provided an anti-E7MC immunoconjugate comprising a) an anti-E7MC antibody moiety that specifically binds to a complex comprising an HPV16-E7 peptide and an MHC class I protein comprising i) a heavy chain variable domain sequence comprising an HC-CDR1 comprising the amino acid sequence of SEQ ID
NO: 183, or a variant thereof comprising up to about 3 (for example about any of 1, 2, or 3) amino acid substitutions, an HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 184 or 185, or a variant thereof comprising up to about 3 (for example about any of 1, 2, or 3) amino acid substitutions, and an HC-CDR3 comprising the amino acid sequence of any one of SEQ ID NOs: 186-188, or a variant thereof comprising up to about 3 (for example about any of 1, 2, or 3) amino acid substitutions; and ii) a light chain variable domain comprising an LC-CDR1 comprising the amino acid sequence of SEQ ID NO: 189 or 190, or a variant thereof comprising up to about 3 (for example about any of 1, 2, or 3) amino acid
substitutions, and an LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 191, or a variant thereof comprising up to about 3 (for example about any of 1, 2, or 3) amino acid substitutions, and b) an effector molecule.
[0376] In some embodiments, there is provided an anti-E7MC immunoconjugate comprising a) an anti-E7MC antibody moiety that specifically binds to a complex comprising an HPV16-E7 peptide and an MHC class I protein comprising i) a heavy chain variable domain sequence comprising an HC-CDR1 comprising the amino acid sequence of SEQ ID NO: 183, an HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 184 or 185, and an HC-CDR3 comprising the amino acid sequence of any one of SEQ ID NOs: 186-188; and ii) a light chain variable domain comprising an LC-CDR1 comprising the amino acid sequence of SEQ ID NO: 189 or 190, and an LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 191, and b) an effector molecule.
[0377] In some embodiments, there is provided an anti-E7MC immunoconjugate comprising a) an anti-E7MC antibody moiety that specifically binds to a complex comprising an HPV16-E7 peptide and an MHC class I protein comprising i) a heavy chain variable domain comprising an HC-CDR1 comprising the amino acid sequence of any one of SEQ ID
NOs: 57-77, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or
5) amino acid substitutions, an HC-CDR2 comprising the amino acid sequence of any one of
SEQ ID NOs: 78-98, or a variant thereof comprising up to about 5 (such as about any of 1, 2,
3, 4, or 5) amino acid substitutions, and an HC-CDR3 comprising the amino acid sequence of any one of SEQ ID NOs: 99-119, 244, and 245, or a variant thereof comprising up to about 5
(such as about any of 1, 2, 3, 4, or 5) amino acid substitutions; and ii) a light chain variable domain comprising an LC-CDR1 comprising the amino acid sequence of any one of SEQ ID
NOs: 120-140 and 246, or a variant thereof comprising up to about 5 (such as about any of 1,
2, 3, 4, or 5) amino acid substitutions, an LC-CDR2 comprising the amino acid sequence of
any one of SEQ ID NOs: 141-161, or a variant thereof comprising up to about 3 (such as about any of 1, 2, or 3) amino acid substitutions, and an LC-CDR3 comprising the amino acid sequence of any one of SEQ ID NOs: 162-182 and 247-250, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions, and b) an effector molecule.
[0378] In some embodiments, there is provided an anti-E7MC immunoconjugate comprising a) an anti-E7MC antibody moiety that specifically binds to a complex comprising an HPV16-E7 peptide and an MHC class I protein comprising i) a heavy chain variable domain sequence comprising an HC-CDR1 comprising the amino acid sequence of any one of SEQ ID NOs: 57-77; an HC-CDR2 comprising the amino acid sequence of any one of SEQ ID NOs: 78-98; and an HC-CDR3 comprising the amino acid sequence of any one of SEQ ID NOs: 99-119, 244, and 245; or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions in the HC-CDR sequences; and ii) a light chain variable domain sequence comprising an LC-CDR1 comprising the amino acid sequence of any one of SEQ ID NOs: 120-140 and 246; an LC-CDR2 comprising the amino acid sequence of any one of SEQ ID NOs: 141-161; and an LC-CDR3 comprising the amino acid sequence of any one of SEQ ID NOs: 162-182 and 247-250; or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions in the LC-CDR sequences, and b) an effector molecule.
[0379] In some embodiments, there is provided an anti-E7MC immunoconjugate comprising a) an anti-E7MC antibody moiety that specifically binds to a complex comprising an HPV16-E7 peptide and an MHC class I protein comprising i) a heavy chain variable domain sequence comprising an HC-CDR 1 comprising the amino acid sequence of any one of SEQ ID NOs: 57-77; an HC-CDR2 comprising the amino acid sequence of any one of SEQ ID NOs: 78-98; and an HC-CDR3 comprising the amino acid sequence of any one of SEQ ID NOs: 99-119, 244, and 245; and ii) a light chain variable domain sequence comprising an LC-CDR 1 comprising the amino acid sequence of any one of SEQ ID NOs: 120-140 and 246; an LC-CDR2 comprising the amino acid sequence of any one of SEQ ID NOs: 141-161; and an LC-CDR3 comprising the amino acid sequence of any one of SEQ ID NOs: 162-182 and 247-250, and b) an effector molecule.
[0380] In some embodiments, there is provided an anti-E7MC immunoconjugate comprising a) an anti-E7MC antibody moiety that specifically binds to a complex comprising an HPV16-E7 peptide and an MHC class I protein comprising a heavy chain variable domain
comprising the amino acid sequence of any one of SEQ ID NOs: 15-35 and 233-237, or a variant thereof having at least about 95% (for example at least about any of 96%, 97%, 98%, or 99%) sequence identity, and a light chain variable domain comprising the amino acid sequence of any one of SEQ ID NOs: 36-56 and 238-243, or a variant thereof having at least about 95% (for example at least about any of 96%, 97%, 98%, or 99%) sequence identity, and b) an effector molecule.
[0381] In some embodiments, there is provided an anti-E7MC immunoconjugate comprising a) an anti-E7MC antibody moiety that specifically binds to a complex comprising an HPV16-E7 peptide and an MHC class I protein comprising a heavy chain variable domain comprising the amino acid sequence of any one of SEQ ID NOs: 15-35 and 233-237 and a light chain variable domain comprising the amino acid sequence of any one of SEQ ID NOs: 36-56 and 238-243, b) an effector molecule.
Nucleic Acids
[0382] Nucleic acid molecules encoding the anti-E7MC constructs or anti-E7MC antibody moieties are also contemplated. In some embodiments, there is provided a nucleic acid (or a set of nucleic acids) encoding a full-length anti-E7MC antibody. In some embodiments, there is provided a nucleic acid (or a set of nucleic acids) encoding a multi- specific anti-E7MC molecule (e.g. , a multi- specific anti-E7MC antibody, a bispecific anti-E7MC antibody, or a bispecific T-cell engager anti-E7MC antibody), or polypeptide portion thereof. In some embodiments, there is provided a nucleic acid (or a set of nucleic acids) encoding an anti- E7MC CAR. In some embodiments, there is provided a nucleic acid (or a set of nucleic acids) encoding an anti-E7MC immunoconjugate, or polypeptide portion thereof.
[0383] The present application also includes variants to these nucleic acid sequences. For example, the variants include nucleotide sequences that hybridize to the nucleic acid sequences encoding the anti-E7MC constructs or anti-E7MC antibody moieties of the present application under at least moderately stringent hybridization conditions.
[0384] The present invention also provides vectors in which a nucleic acid of the present invention is inserted.
[0385] In brief summary, the expression of an anti-E7MC construct (e.g. , anti-E7MC CAR) or polypeptide portion thereof by a natural or synthetic nucleic acid encoding the anti-E7MC construct or polypeptide portion thereof can be achieved by inserting the nucleic acid into an appropriate expression vector, such that the nucleic acid is operably linked to 5' and 3'
regulatory elements, including for example a promoter (e.g., a lymphocyte- specific promoter) and a 3' untranslated region (UTR). The vectors can be suitable for replication and integration in eukaryotic host cells. Typical cloning and expression vectors contain transcription and translation terminators, initiation sequences, and promoters useful for regulation of the expression of the desired nucleic acid sequence.
[0386] The nucleic acids of the present invention may also be used for nucleic acid immunization and gene therapy, using standard gene delivery protocols. Methods for gene delivery are known in the art. See, e.g., U.S. Pat. Nos. 5,399,346, 5,580,859, 5,589,466, incorporated by reference herein in their entireties. In some embodiments, the invention provides a gene therapy vector.
[0387] The nucleic acid can be cloned into a number of types of vectors. For example, the nucleic acid can be cloned into a vector including, but not limited to a plasmid, a phagemid, a phage derivative, an animal virus, and a cosmid. Vectors of particular interest include expression vectors, replication vectors, probe generation vectors, and sequencing vectors.
[0388] Further, the expression vector may be provided to a cell in the form of a viral vector. Viral vector technology is well known in the art and is described, for example, in Sambrook et al. (2001, Molecular Cloning: A Laboratory Manual, Cold Spring Harbor Laboratory, New York), and in other virology and molecular biology manuals. Viruses which are useful as vectors include, but are not limited to, retroviruses, adenoviruses, adeno- associated viruses, herpes viruses, and lentiviruses. In general, a suitable vector contains an origin of replication functional in at least one organism, a promoter sequence, convenient restriction endonuclease sites, and one or more selectable markers (see, e.g. , WO 01/96584; WO 01/29058; and U.S. Pat. No. 6,326,193).
[0389] A number of viral based systems have been developed for gene transfer into mammalian cells. For example, retroviruses provide a convenient platform for gene delivery systems. A selected gene can be inserted into a vector and packaged in retroviral particles using techniques known in the art. The recombinant virus can then be isolated and delivered to cells of the subject either in vivo or ex vivo. A number of retroviral systems are known in the art. In some embodiments, adenovirus vectors are used. A number of adenovirus vectors are known in the art. In some embodiments, lentivirus vectors are used. Vectors derived from retroviruses such as the lentivirus are suitable tools to achieve long-term gene transfer since they allow long-term, stable integration of a transgene and its propagation in daughter cells.
Lentiviral vectors have the added advantage over vectors derived from onco-retroviruses such
as murine leukemia viruses in that they can transduce non-proliferating cells, such as hepatocytes. They also have the added advantage of low immunogenicity.
[0390] Additional promoter elements, e.g. , enhancers, regulate the frequency of transcriptional initiation. Typically, these are located in the region 30-110 bp upstream of the start site, although a number of promoters have recently been shown to contain functional elements downstream of the start site as well. The spacing between promoter elements frequently is flexible, so that promoter function is preserved when elements are inverted or moved relative to one another. In the thymidine kinase (tk) promoter, the spacing between promoter elements can be increased to 50 bp apart before activity begins to decline.
[0391] One example of a suitable promoter is the immediate early cytomegalovirus (CMV) promoter sequence. This promoter sequence is a strong constitutive promoter sequence capable of driving high levels of expression of any polynucleotide sequence operatively linked thereto. Another example of a suitable promoter is Elongation Growth Factor- la (EF- la). However, other constitutive promoter sequences may also be used, including, but not limited to the simian virus 40 (SV40) early promoter, mouse mammary tumor virus
(MMTV), human immunodeficiency virus (HIV) long terminal repeat (LTR) promoter, MoMuLV promoter, an avian leukemia virus promoter, an Epstein-Barr virus immediate early promoter, a Rous sarcoma virus promoter, as well as human gene promoters such as, but not limited to, the actin promoter, the myosin promoter, the hemoglobin promoter, and the creatine kinase promoter. Further, the invention should not be limited to the use of constitutive promoters. Inducible promoters are also contemplated as part of the invention. The use of an inducible promoter provides a molecular switch capable of turning on expression of the polynucleotide sequence which it is operatively linked when such expression is desired, or turning off the expression when expression is not desired. Examples of inducible promoters include, but are not limited to a metallothionine promoter, a glucocorticoid promoter, a progesterone promoter, and a tetracycline promoter.
[0392] In order to assess the expression of a polypeptide or portions thereof, the expression vector to be introduced into a cell can also contain either a selectable marker gene or a reporter gene or both to facilitate identification and selection of expressing cells from the population of cells sought to be transfected or infected through viral vectors. In other aspects, the selectable marker may be carried on a separate piece of DNA and used in a co- transfection procedure. Both selectable markers and reporter genes may be flanked with
appropriate regulatory sequences to enable expression in the host cells. Useful selectable markers include, for example, antibiotic -resistance genes, such as neo and the like.
[0393] Reporter genes are used for identifying potentially transfected cells and for evaluating the functionality of regulatory sequences. In general, a reporter gene is a gene that is not present in or expressed by the recipient organism or tissue and that encodes a polypeptide whose expression is manifested by some easily detectable property, e.g., enzymatic activity. Expression of the reporter gene is assayed at a suitable time after the DNA has been introduced into the recipient cells. Suitable reporter genes may include genes encoding luciferase, β-galactosidase, chloramphenicol acetyl transferase, secreted alkaline phosphatase, or the green fluorescent protein gene (e.g., Ui-Tel et ah, 2000 FEBS Letters 479: 79-82). Suitable expression systems are well known and may be prepared using known techniques or obtained commercially. In general, the construct with the minimal 5' flanking region showing the highest level of expression of reporter gene is identified as the promoter. Such promoter regions may be linked to a reporter gene and used to evaluate agents for the ability to modulate promoter-driven transcription.
[0394] Methods of introducing and expressing genes into a cell are known in the art. In the context of an expression vector, the vector can be readily introduced into a host cell, e.g., mammalian, bacterial, yeast, or insect cell by any method in the art. For example, the expression vector can be transferred into a host cell by physical, chemical, or biological means.
[0395] Physical methods for introducing a polynucleotide into a host cell include calcium phosphate precipitation, lipofection, particle bombardment, microinjection, electroporation, and the like. Methods for producing cells comprising vectors and/or exogenous nucleic acids are well-known in the art. See, for example, Sambrook et al. (2001, Molecular Cloning: A Laboratory Manual, Cold Spring Harbor Laboratory, New York). In some embodiments, the introduction of a polynucleotide into a host cell is carried out by calcium phosphate transfection.
[0396] Biological methods for introducing a polynucleotide of interest into a host cell include the use of DNA and RNA vectors. Viral vectors, and especially retroviral vectors, have become the most widely used method for inserting genes into mammalian, e.g., human cells. Other viral vectors can be derived from lentivirus, poxviruses, herpes simplex virus 1, adenoviruses and adeno-associated viruses, and the like. See, for example, U.S. Pat. Nos. 5,350,674 and 5,585,362.
[0397] Chemical means for introducing a polynucleotide into a host cell include colloidal dispersion systems, such as macromolecule complexes, nanocapsules, microspheres, beads, and lipid-based systems including oil-in-water emulsions, micelles, mixed micelles, and liposomes. An exemplary colloidal system for use as a delivery vehicle in vitro and in vivo is a liposome (e.g., an artificial membrane vesicle).
[0398] In the case where a non-viral delivery system is utilized, an exemplary delivery vehicle is a liposome. The use of lipid formulations is contemplated for the introduction of the nucleic acids into a host cell (in vitro, ex vivo or in vivo). In another aspect, the nucleic acid may be associated with a lipid. The nucleic acid associated with a lipid may be encapsulated in the aqueous interior of a liposome, interspersed within the lipid bilayer of a liposome, attached to a liposome via a linking molecule that is associated with both the liposome and the oligonucleotide, entrapped in a liposome, complexed with a liposome, dispersed in a solution containing a lipid, mixed with a lipid, combined with a lipid, contained as a suspension in a lipid, contained or complexed with a micelle, or otherwise associated with a lipid. Lipid, lipid/DNA or lipid/expression vector associated compositions are not limited to any particular structure in solution. For example, they may be present in a bilayer structure, as micelles, or with a "collapsed" structure. They may also simply be interspersed in a solution, possibly forming aggregates that are not uniform in size or shape. Lipids are fatty substances which may be naturally occurring or synthetic lipids. For example, lipids include the fatty droplets that naturally occur in the cytoplasm as well as the class of compounds which contain long-chain aliphatic hydrocarbons and their derivatives, such as fatty acids, alcohols, amines, amino alcohols, and aldehydes.
[0399] Regardless of the method used to introduce exogenous nucleic acids into a host cell or otherwise expose a cell to the inhibitor of the present invention, in order to confirm the presence of the recombinant DNA sequence in the host cell, a variety of assays may be performed. Such assays include, for example, "molecular biological" assays well known to those of skill in the art, such as Southern and Northern blotting, RT-PCR and PCR;
"biochemical" assays, such as detecting the presence or absence of a particular peptide, e.g., by immunological means (ELISAs and Western blots) or by assays described herein to identify agents falling within the scope of the invention.
MHC class I proteins
[0400] MHC class I proteins are one of two primary classes of major histocompatibility complex (MHC) molecules (the other being MHC class II) and are found on nearly every nucleated cell of the body. Their function is to display fragments of proteins from within the cell to T cells; healthy cells will be ignored, while cells containing foreign proteins will be attacked by the immune system. Because MHC class I proteins present peptides derived from cytosolic proteins, the pathway of MHC class I presentation is often called the cytosolic or endogenous pathway. Class I MHC molecules bind peptides generated mainly from degradation of cytosolic proteins by the proteasome. The MHC Lpeptide complex is then inserted into the plasma membrane of the cell. The peptide is bound to the extracellular part of the class I MHC molecule. Thus, the function of the class I MHC is to display intracellular proteins to cytotoxic T cells (CTLs). However, class I MHC can also present peptides generated from exogenous proteins, in a process known as cross-presentation.
[0401] MHC class I proteins consist of two polypeptide chains, a and p2-microglobulin (β2Μ). The two chains are linked noncovalently via interaction of b2m and the a3 domain. Only the a chain is polymorphic and encoded by a HLA gene, while the b2m subunit is not polymorphic and encoded by the β-2 microglobulin gene. The a3 domain is plasma membrane- spanning and interacts with the CD8 co-receptor of T-cells. The a3-CD8 interaction holds the MHC I molecule in place while the T cell receptor (TCR) on the surface of the cytotoxic T cell binds its al-a2 heterodimer ligand, and checks the coupled peptide for antigenicity. The al and a2 domains fold to make up a groove for peptides to bind. MHC class I proteins bind peptides that are 8-10 amino acid in length.
[0402] The human leukocyte antigen (HLA) genes are the human versions of the MHC genes. The three major MHC class I proteins in humans are HLA-A, HLA-B, and HLA-C, while the 3 minor ones are HLA-E, HLA-F, and HLA-G. HLA-A is ranked among the genes in humans with the fastest-evolving coding sequence. As of December 2013, there were 2432 known HLA-A alleles coding for 1740 active proteins and 117 null proteins. The HLA-A gene is located on the short arm of chromosome 6 and encodes the larger, a-chain, constituent of HLA-A. Variation of HLA-A a-chain is key to HLA function. This variation promotes genetic diversity in the population. Since each HLA has a different affinity for peptides of certain structures, greater variety of HLAs means greater variety of antigens to be 'presented' on the cell surface, enhancing the likelihood that a subset of the population will be resistant to any given foreign invader. This decreases the likelihood that a single pathogen has the
capability to wipe out the entire human population. Each individual can express up to two types of HLA-A, one from each of their parents. Some individuals will inherit the same HLA-A from both parents, decreasing their individual HLA diversity; however, the majority of individuals will receive two different copies of HLA-A. This same pattern follows for all HLA groups. In other words, a person can only express either one or two of the 2432 known HLA-A alleles.
[0403] All alleles receive at least a four digit classification, e.g. , HLA-A*02: 12. The A signifies which HLA gene the allele belongs to. There are many HLA-A alleles, so that classification by serotype simplifies categorization. The next pair of digits indicates this assignment. For example, HLA-A*02:02, HLA-A*02:04, and HLA-A*02:324 are all members of the A2 serotype (designated by the *02 prefix). This group is the primary factor responsible for HLA compatibility. All numbers after this cannot be determined by serotyping and are designated through gene sequencing. The second set of digits indicates what HLA protein is produced. These are assigned in order of discovery and as of December
2013 there are 456 different HLA-A02 proteins known (assigned names HLA-A*02:01 to
HLA-A*02:456). The shortest possible HLA name includes both of these details. Each extension beyond that signifies a nucleotide change that may or may not change the protein.
[0404] In some embodiments, the anti-E7MC antibody moiety specifically binds to a complex comprising an HPV16-E7 peptide and an MHC class I protein, wherein the MHC class I protein is HLA-A, HLA-B, HLA-C, HLA-E, HLA-F, or HLA-G. In some
embodiments, the MHC class I protein is HLA-A, HLA-B, or HLA-C. In some embodiments, the MHC class I protein is HLA-A. In some embodiments, the MHC class I protein is HLA-
B. In some embodiments, the MHC class I protein is HLA-C. In some embodiments, the
MHC class I protein is HLA-A01, HLA-A02, HLA-A03, HLA-A09, HLA-A 10, HLA-A11,
HLA-A 19, HLA-A23, HLA-A24, HLA-A25, HLA-A26, HLA-A28, HLA-A29, HLA-A30,
HLA- A31, HLA-A32, HLA- A33, HLA-A34, HLA-A36, HLA-A43, HLA-A66, HLA-A68,
HLA-A69, HLA-A74, or HLA-A80. In some embodiments, the MHC class I protein is HLA-
A02. In some embodiments, the MHC class I protein is any one of HLA-A*02:01-555, such as HLA-A*02:01, HLA-A*02:02, HLA-A*02:03, HLA-A*02:04, HLA-A*02:05, HLA-
A*02:06, HLA-A*02:07, HLA-A*02:08, HLA-A*02:09, HLA-A*02: 10, HLA-A*02: 11,
HLA-A*02: 12, HLA-A*02: 13, HLA-A*02: 14, HLA-A*02: 15, HLA-A*02: 16, HLA-
A*02: 17, HLA-A*02: 18, HLA-A*02: 19, HLA-A*02:20, HLA-A*02:21, HLA-A*02:22, or
HLA-A*02:24. In some embodiments, the MHC class I protein is HLA-A*02:01. HLA-
A*02:01 is expressed in 39-46% of all Caucasians, and therefore represents a suitable choice of MHC class I protein for use in the present invention.
[0405] HPV16-E7 peptides suitable for use in generating anti-E7MC antibody moieties can be determined, for example, based on the presence of HLA-A*02:01 -binding motifs and cleavage sites for proteasomes and immune-proteasomes using computer prediction models known to those of skill in the art. For predicting MHC binding sites, such models include, but are not limited to, IEDB (Vita et al., The immune epitope database (IEDB) 3.0. Nucleic Acids Res. 2014 Oct 9. pii: gku938), ProPredl (described in more detail in Singh and Raghava, ProPred: prediction ofHLA-DR binding sites. BIOINFORMATICS 17(12): 1236- 1237, 2001), and SYFPEITHI (see Schuler et al. SYFPEITHI, Database for Searching and T-Cell Epitope Prediction, in Immunoinformatics Methods in Molecular Biology, vol 409(1): 75-93, 2007).
[0406] Once appropriate peptides have been identified, peptide synthesis may be done in accordance with protocols well known to those of skill in the art. Because of their relatively small size, the peptides of the invention may be directly synthesized in solution or on a solid support in accordance with conventional peptide synthesis techniques. Various automatic synthesizers are commercially available and can be used in accordance with known protocols. The synthesis of peptides in solution phase has become a well-established procedure for large-scale production of synthetic peptides and as such is a suitable alternative method for preparing the peptides of the invention (See for example, Solid Phase Peptide Synthesis by John Morrow Stewart and Martin et al. Application of Almez-mediated Amidation Reactions to Solution Phase Peptide Synthesis, Tetrahedron Letters Vol. 39, pages 1517-1520, 1998).
[0407] The binding activity of candidate HPV16-E7 peptides can be tested using the antigen -processing-deficient T2 cell line, which increases expression of HLA-A when stabilized by a peptide in the antigen-presenting groove. T2 cells are pulsed with the candidate peptide for a time sufficient to stabilize HLA-A expression on the cell surface, which can be measured using any methods known in the art, such as by immuno staining with a fluorescently labeled monoclonal antibody specific for HLA-A (for example, BB7.2) followed by fluorescence-activated cell-sorting (FACS) analysis.
Preparation of anti-E7MC antibodies and anti-E7MC antibody moieties
[0408] In some embodiments, the anti-E7MC antibody or anti-E7MC antibody moiety is a monoclonal antibody. Monoclonal antibodies can be prepared, e.g., using hybridoma methods, such as those described by Kohler and Milstein, Nature, 256:495 (1975) and
Sergeeva et al, Blood, 117(16):4262-4272, using the phage display methods described herein and in the Examples below, or using recombinant DNA methods {see, e.g., US Patent No. 4,816,567).
[0409] In a hybridoma method, a hamster, mouse, or other appropriate host animal is typically immunized with an immunizing agent to elicit lymphocytes that produce or are capable of producing antibodies that will specifically bind to the immunizing agent.
Alternatively, the lymphocytes can be immunized in vitro. The immunizing agent can include a polypeptide or a fusion protein of the protein of interest, or a complex comprising at least two molecules, such as a complex comprising an HPV16-E7 peptide and an MHC class I protein. Generally, peripheral blood lymphocytes ("PBLs") are used if cells of human origin are desired, or spleen cells or lymph node cells are used if non-human mammalian sources are desired. The lymphocytes are then fused with an immortalized cell line using a suitable fusing agent, such as polyethylene glycol, to form a hybridoma cell. See, e.g., Goding, Monoclonal Antibodies: Principles and Practice (New York: Academic Press, 1986), pp. 59- 103. Immortalized cell lines are usually transformed mammalian cells, particularly myeloma cells of rodent, bovine, and human origin. Usually, rat or mouse myeloma cell lines are employed. The hybridoma cells can be cultured in a suitable culture medium that preferably contains one or more substances that inhibit the growth or survival of the unfused, immortalized cells. For example, if the parental cells lack the enzyme hypoxanthine guanine phosphoribosyl transferase (HGPRT or HPRT), the culture medium for the hybridomas typically will include hypoxanthine, aminopterin, and thymidine ("HAT medium"), which prevents the growth of HGPRT-deficient cells.
[0410] In some embodiments, the immortalized cell lines fuse efficiently, support stable high-level expression of antibody by the selected antibody-producing cells, and are sensitive to a medium such as HAT medium. In some embodiments, the immortalized cell lines are murine myeloma lines, which can be obtained, for instance, from the Salk Institute Cell Distribution Center, San Diego, California and the American Type Culture Collection, Manassas, Virginia. Human myeloma and mouse-human heteromyeloma cell lines also have been described for the production of human monoclonal antibodies. Kozbor, J. Immunol., 133:3001 (1984); Brodeur et al. Monoclonal Antibody Production Techniques and
Applications (Marcel Dekker, Inc.: New York, 1987) pp. 51-63.
[0411] The culture medium in which the hybridoma cells are cultured can then be assayed for the presence of monoclonal antibodies directed against the polypeptide. The binding
specificity of monoclonal antibodies produced by the hybridoma cells can be determined by immunoprecipitation or by an in vitro binding assay, such as radioimmunoassay (RIA) or enzyme-linked immunoabsorbent assay (ELISA). Such techniques and assays are known in the art. The binding affinity of the monoclonal antibody can, for example, be determined by the Scatchard analysis of Munson and Pollard, Anal. Biochem., 107:220 (1980).
[0412] After the desired hybridoma cells are identified, the clones can be sub cloned by limiting dilution procedures and grown by standard methods. Goding, supra. Suitable culture media for this purpose include, for example, Dulbecco's Modified Eagle's Medium and RPMI-1640 medium. Alternatively, the hybridoma cells can be grown in vivo as ascites in a mammal.
[0413] The monoclonal antibodies secreted by the sub clones can be isolated or purified from the culture medium or ascites fluid by conventional immunoglobulin purification procedures such as, for example, protein A-Sepharose, hydroxylapatite chromatography, gel electrophoresis, dialysis, or affinity chromatography.
[0414] The anti-E7MC antibodies or antibody moieties may also be identified by screening combinatorial libraries for antibodies with the desired activity or activities. For example, a variety of methods are known in the art for generating phage display libraries and screening such libraries for antibodies possessing the desired binding characteristics. Such methods are reviewed, e.g., in Hoogenboom et ah, Methods in Molecular Biology 178: 1-37 (O'Brien et ah, ed., Human Press, Totowa, N.J., 2001) and further described, e.g., in McCafferty et ah, Nature 348:552-554; Clackson et al, Nature 352: 624-628 (1991); Marks et al, J. Mol. Biol. 222: 581-597 (1992); Marks and Bradbury, Methods in Molecular Biology 248: 161-175 (Lo, ed., Human Press, Totowa, N.J., 2003); Sidhu et al., J. Mol. Biol. 338(2): 299-310 (2004); Lee et al., J. Mol. Biol. 340(5): 1073-1093 (2004); Fellouse, Proc. Natl. Acad. Sci. USA 101(34): 12467-12472 (2004); and Lee et al., J. Immunol. Methods 284(1-2): 119-132(2004).
[0415] In certain phage display methods, repertoires of VH and VL genes are separately cloned by polymerase chain reaction (PCR) and recombined randomly in phage libraries, which can then be screened for antigen -binding phage as described in Winter et al. , Ann. Rev. Immunol., 12: 433-455 (1994). Phage typically display antibody fragments, either as single- chain Fv (scFv) fragments or as Fab fragments. Libraries from immunized sources provide high-affinity antibodies to the immunogen without the requirement of constructing hybridomas. Alternatively, the naive repertoire can be cloned {e.g., from human) to provide a single source of antibodies to a wide range of non-self and also self antigens without any
immunization as described by Griffiths et al, EMBO J, 12: 725-734 (1993). Finally, naive libraries can also be made synthetically by cloning unrearranged V-gene segments from stem cells, and using PCR primers containing random sequence to encode the highly variable CDR3 regions and to accomplish rearrangement in vitro, as described by Hoogenboom and Winter, J. Mol. Biol, 227: 381-388 (1992). Patent publications describing human antibody phage libraries include, for example: U.S. Pat. No. 5,750,373, and US Patent Publication Nos. 2005/0079574, 2005/0119455, 2005/0266000, 2007/0117126, 2007/0160598, 2007/0237764, 2007/0292936, and 2009/0002360.
[0416] The antibodies or antigen-binding fragments thereof can be prepared using phage display to screen libraries for antibodies specific to a complex comprising an HPV16-E7 peptide and an MHC class I protein. The library can be a human scFv phage display library having a diversity of at least one x 109 (such as at least about any of 1 x 109, 2.5 x 109, 5 x 109, 7.5 x 109, 1 x 1010, 2.5 x 1010, 5 x 1010, 7.5 x 1010, or 1 x 1011) unique human antibody fragments. In some embodiments, the library is a naive human library constructed from DNA extracted from human PMBCs and spleens from healthy donors, encompassing all human heavy and light chain subfamilies. In some embodiments, the library is a naive human library constructed from DNA extracted from PBMCs isolated from patients with various diseases, such as patients with autoimmune diseases, cancer patients, and patients with infectious diseases. In some embodiments, the library is a semi-synthetic human library, wherein heavy chain CDR3 is completely randomized, with all amino acids (with the exception of cysteine) equally likely to be present at any given position {see, e.g., Hoet, R.M. et al, Nat. Biotechnol. 23(3):344-348, 2005). In some embodiments, the heavy chain CDR3 of the semi- synthetic human library has a length from about 5 to about 24 (such as about any of 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, or 24) amino acids. In some embodiments, the library is a non-human phage display library.
[0417] Phage clones that bind to the E7MC with high affinity can be selected by iterative binding of phage to the E7MC, which is bound to a solid support (such as, for example, beads for solution panning or mammalian cells for cell panning), followed by removal of non- bound phage and by elution of specifically bound phage. In an example of solution panning, the E7MC can be biotinylated for immobilization to a solid support. The biotinylated E7MC is mixed with the phage library and a solid support, such as strep tavidin-conjugated
Dynabeads M-280, and then E7MC-phage-bead complexes are isolated. The bound phage clones are then eluted and used to infect an appropriate host cell, such as E. coli XLl-Blue,
for expression and purification. In an example of cell panning, T2 cells (a TAP-deficient, HLA-A*02:01+ lymphoblast cell line) loaded with the HPV16-E7 peptide of the E7MC are mixed with the phage library, after which the cells are collected and the bound clones are eluted and used to infect an appropriate host cell for expression and purification. The panning can be performed for multiple (such as about any of 2, 3, 4, 5, 6 or more) rounds with either solution panning, cell panning, or a combination of both, to enrich for phage clones binding specifically to the E7MC. Enriched phage clones can be tested for specific binding to the E7MC by any methods known in the art, including for example ELISA and FACS.
[0418] Monoclonal antibodies can also be made by recombinant DNA methods, such as those described in U.S. Patent No. 4,816,567. DNA encoding the monoclonal antibodies of the invention can be readily isolated and sequenced using conventional procedures (e.g., by using oligonucleotide probes that are capable of binding specifically to genes encoding the heavy and light chains of murine antibodies). Hybridoma cells as described above or E7MC- specific phage clones of the invention can serve as a source of such DNA. Once isolated, the DNA can be placed into expression vectors, which are then transfected into host cells such as simian COS cells, Chinese hamster ovary (CHO) cells, or myeloma cells that do not otherwise produce immunoglobulin protein, to obtain the synthesis of monoclonal antibodies in the recombinant host cells. The DNA also can be modified, for example, by substituting the coding sequence for human heavy- and light-chain constant domains and/or framework regions in place of the homologous non-human sequences (U.S. Patent No. 4,816,567;
Morrison et ah, supra) or by covalently joining to the immunoglobulin coding sequence all or part of the coding sequence for a nonimmunoglobulin polypeptide. Such a non- immunoglobulin polypeptide can be substituted for the constant domains of an antibody of the invention, or can be substituted for the variable domains of one antigen-combining site of an antibody of the invention to create a chimeric bivalent antibody.
[0419] The antibodies can be monovalent antibodies. Methods for preparing monovalent antibodies are known in the art. For example, one method involves recombinant expression of immunoglobulin light chain and modified heavy chain. The heavy chain is truncated generally at any point in the Fc region so as to prevent heavy-chain crosslinking.
Alternatively, the relevant cysteine residues are substituted with another amino acid residue or are deleted so as to prevent crosslinking.
[0420] In vitro methods are also suitable for preparing monovalent antibodies. Digestion of antibodies to produce fragments thereof, particularly Fab fragments, can be accomplished using any method known in the art.
[0421] Antibody variable domains with the desired binding specificities (antibody-antigen combining sites) can be fused to immunoglobulin constant-domain sequences. The fusion preferably is with an immunoglobulin heavy-chain constant domain, comprising at least part of the hinge, CH2, and CH3 regions. In some embodiments, the first heavy-chain constant region (CHI) containing the site necessary for light-chain binding is present in at least one of the fusions. DNAs encoding the immunoglobulin heavy-chain fusions and, if desired, the immunoglobulin light chain, are inserted into separate expression vectors, and are co- transfected into a suitable host organism. For further details of generating bispecific antibodies, see, for example, Suresh et ah, Methods in Enzymology, 121: 210 (1986).
Human and Humanized Antibodies
[0422] The anti-E7MC antibodies or antibody moieties can be humanized antibodies or human antibodies. Humanized forms of non-human (e.g., murine) antibodies are chimeric immunoglobulins, immunoglobulin chains, or fragments thereof (such as Fv, Fab, Fab', F(ab')2, scFv, or other antigen-binding subsequences of antibodies) that typically contain minimal sequence derived from non-human immunoglobulin. Humanized antibodies include human immunoglobulins (recipient antibody) in which residues from a CDR of the recipient are replaced by residues from a CDR of a non-human species (donor antibody) such as mouse, rat, or rabbit having the desired specificity, affinity, and capacity. In some instances, Fv framework residues of the human immunoglobulin are replaced by corresponding non- human residues. Humanized antibodies can also comprise residues that are found neither in the recipient antibody nor in the imported CDR or framework sequences. In general, the humanized antibody can comprise substantially all of at least one, and typically two, variable domains, in which all or substantially all of the CDR regions correspond to those of a non- human immunoglobulin, and all or substantially all of the FR regions are those of a human immunoglobulin consensus sequence. In some embodiments, the humanized antibody will comprise at least a portion of an immunoglobulin constant region (Fc), typically that of a human immunoglobulin. See, e.g., Jones et ah, Nature, 321: 522-525 (1986); Riechmann et al, Nature, 332: 323-329 (1988); Presta, Curr. Op. Struct. Biol, 2:593-596 (1992).
[0423] Generally, a humanized antibody has one or more amino acid residues introduced into it from a source that is non-human. These non-human amino acid residues are often referred to as "import" residues, which are typically taken from an "import" variable domain. According to some embodiments, humanization can be essentially performed following the method of Winter and co-workers (Jones et ah, Nature, 321: 522-525 (1986); Riechmann et al, Nature, 332: 323-327 (1988); Verhoeyen et al., Science, 239: 1534-1536 (1988)), by substituting rodent CDRs or CDR sequences for the corresponding sequences of a human antibody. Accordingly, such "humanized" antibodies are antibodies (U.S. Patent No.
4,816,567), wherein substantially less than an intact human variable domain has been substituted by the corresponding sequence from a non-human species. In practice, humanized antibodies are typically human antibodies in which some CDR residues and possibly some FR residues are substituted by residues from analogous sites in rodent antibodies.
[0424] As an alternative to humanization, human antibodies can be generated. For example, it is now possible to produce transgenic animals (e.g., mice) that are capable, upon
immunization, of producing a full repertoire of human antibodies in the absence of endogenous immunoglobulin production. For example, it has been described that the homozygous deletion of the antibody heavy-chain joining region (JH) gene in chimeric and germ-line mutant mice results in complete inhibition of endogenous antibody production. Transfer of the human germ-line immunoglobulin gene array into such germ-line mutant mice will result in the production of human antibodies upon antigen challenge. See, e.g., Jakobovits et al., PNAS USA, 90:2551 (1993); Jakobovits et al., Nature, 362:255-258 (1993); Bruggemann et al., Year in Immunol., 7:33 (1993); U.S. Patent Nos. 5,545,806, 5,569,825, 5,591,669; 5,545,807; and WO 97/17852. Alternatively, human antibodies can be made by introducing human immunoglobulin loci into transgenic animals, e.g., mice in which the endogenous immunoglobulin genes have been partially or completely inactivated. Upon challenge, human antibody production is observed that closely resembles that seen in humans in all respects, including gene rearrangement, assembly, and antibody repertoire. This approach is described, for example, in U.S. Patent Nos. 5,545,807; 5,545,806; 5,569,825; 5,625,126; 5,633,425; and 5,661,016, and Marks et al, Bio/Technology, 10: 779-783 (1992); Lonberg et al, Nature, 368: 856-859 (1994); Morrison, Nature, 368: 812-813 (1994);
Fishwild et al, Nature Biotechnology, 14: 845-851 (1996); Neuberger, Nature
Biotechnology, 14: 826 (1996); Lonberg and Huszar, Intern. Rev. Immunol, 13: 65-93 (1995).
[0425] Human antibodies may also be generated by in vitro activated B cells (see U.S. Patents 5,567,610 and 5,229,275) or by using various techniques known in the art, including phage display libraries. Hoogenboom and Winter, J. Mol. Biol., 227:381 (1991); Marks et al., J. Mol. Biol., 222:581 (1991). The techniques of Cole et al. and Boerner et al. are also available for the preparation of human monoclonal antibodies. Cole et al., Monoclonal Antibodies and Cancer Therapy, Alan R. Liss, p. 77 (1985) and Boerner et al., J. Immunol., 147(1): 86-95 (1991).
Multi-specific Antibodies
[0426] In some embodiments, the anti-E7MC construct is a multi- specific antibody.
Suitable methods for making multi- specific (e.g., bispecific) antibodies are well known in the art. For example, the production of bispecific antibodies can based on the co-expression of two immunoglobulin heavy-chain/light-chain pairs, where the two pairs each have different specificities, and upon association result in a heterodimeric antibody (see, e.g., Milstein and Cuello, Nature, 305: 537-539 (1983); WO 93/08829, and Traunecker et al, EMBO J. 10: 3655 (1991)). Because of the random assortment of immunoglobulin heavy and light chains, these hybridomas (quadromas) produce a potential mixture of ten different antibody molecules, of which only one has the correct bispecific structure. The purification of the correct molecule is usually accomplished by affinity chromatography steps. Similar procedures are disclosed in WO 93/08829 and in Traunecker et al, EMBO, 10: 3655-3659 (1991). Alternatively, the combining of heavy and light chains can be directed by taking advantage of species-restricted pairing (see, e.g., Lindhofer et al., J. Immunol., 155:219-225 (1995)) and the pairing of heavy chains can be directed by use of "knob-into hole"
engineering of CH3 domains (see, e.g., U.S. Pat. No. 5,731,168; Ridgway et al., Protein Eng., 9(7):617-621 (1996)). Multi- specific antibodies may also be made by engineering electrostatic steering effects for making antibody Fc -heterodimeric molecules (see, e.g., WO 2009/089004A1). In yet another method, stable bispecific antibodies can be generated by controlled Fab-arm exchange, where two parental antibodies having distinct antigen specificity and matched point mutations in the CH3 domains are mixed in reducing condition to allow for separation, reassembly, and reoxidation to form highly pure bispecific antibodies. Labrigin et al, Proc. Natl. Acad. Set, 110(13):5145-5150 (2013). Such antibodies, comprising a mixture of heavy-chain/light-chain pairs, are also referred to herein as
"heteromultimeric antibodies".
[0427] Antibodies or antigen-binding fragments thereof having different specificities can also be chemically cross-linked to generate multi- specific heteroconjugate antibodies. For example, two F(ab')2 molecules, each having specificity for a different antigen, can be chemically linked. Pullarkat et al, Trends Biotechnol, 48:9-21 (1999). Such antibodies have, for example, been proposed to target immune-system cells to unwanted cells (U.S. Patent No. 4,676,980), and for treatment of HIV infection. WO 91/00360; WO 92/200373; EP 03089. It is contemplated that the antibodies can be prepared in vitro using known methods in synthetic protein chemistry, including those involving crosslinking agents. For example, immunotoxins
can be constructed using a disulfide-exchange reaction or by forming a thioether bond.
Examples of suitable reagents for this purpose include iminothiolate and methyl-4- mercaptobutyrimidate and those disclosed, for example, in U.S. Patent No. 4,676,980.
[0428] In some embodiments, multi- specific antibodies can be prepared using recombinant DNA techniques. For example, a bispecific antibody can be engineered by fusing two scFvs, such as by fusing them through a peptide linker, resulting in a tandem scFv. One example of a tandem scFv is a bispecific T cell engager. Bispecific T cell engagers are made by linking an anti-CD3 scFv to an scFv specific for a surface antigen of a target cell, such as a tumor- associated antigen (TAA), resulting in the redirection of T cells to the target cells. Mack et al, Proc. Natl. Acad. Set, 92:7021-7025 (1995); Brischwein et al, Mol. Immunol,
43(8): 1129-1143 (2006). By shortening the length of a peptide linker between two variable domains, they can be prevented from self-assembling and forced to pair with domains on a second polypeptide, resulting in a compact bispecific antibody called a diabody (Db).
Holliger et al, Proc. Natl. Acad. Set, 90:6444-6448 (1993). The two polypeptides of a Db each comprise a VH connected to a VL by a linker which is too short to allow pairing between the two domains on the same chain. Accordingly, the VH and VL domains of one polypeptide are forced to pair with the complementary VL and VH domains of another polypeptide, thereby forming two antigen-binding sites. In a modification of this format, the two polypeptides are linked by another peptide linker, resulting in a single chain diabody (scDb). In yet another modification of the Db format, dual-affinity retargeting (DART) bispecific antibodies can be generated by introducing a disulfide linkage between cysteine residues at the C-terminus of each polypeptide, optionally including domains prior to the C- terminal cysteine residues that drive assembly of the desired heterodimeric structure. Veri et al, Arthritis Rheum., 62(7): 1933-1943 (2010). Dual-variable-domain immunoglobulins (DVD-Ig™), in which the target-binding variable domains of two monoclonal antibodies are combined via naturally occurring linkers to yield a tetravalent, bispecific antibody, are also known in the art. Gu and Ghayur, Methods Enzymol, 502:25-41 (2012). In yet another format, Dock and Lock (DNL), bispecific antibodies are prepared by taking advantage of the dimerization of a peptide (DDD2) derived from the regulatory subunit of human cAMP- dependent protein kinase (PKA) with a peptide (AD2) derived from the anchoring domains of human A kinase anchor proteins (AKAPs). Rossi et al, Proc. Natl. Acad. Set, 103:6841- 6846 (2006).
[0429] Various techniques for making and isolating bispecific antibody fragments directly from recombinant cell culture have also been described. For example, bispecific antibodies have been produced using leucine zippers. Kostelny et ah, J. Immunol., 148(5): 1547-1553 (1992). This method can also be utilized for the production of antibody homodimers.
Anti-E7MC variants
[0430] In some embodiments, amino acid sequence variants of the antibody moieties provided herein are contemplated. For example, it may be desirable to improve the binding affinity and/or other biological properties of the antibody moiety. Amino acid sequence variants of an antibody moiety may be prepared by introducing appropriate modifications into the nucleotide sequence encoding the antibody moiety, or by peptide synthesis. Such modifications include, for example, deletions from, and/or insertions into and/or substitutions of residues within the amino acid sequences of the antibody moiety. Any combination of deletion, insertion, and substitution can be made to arrive at the final construct, provided that the final construct possesses the desired characteristics, e.g., antigen-binding.
[0431] In some embodiments, antibody moiety variants having one or more amino acid substitutions are provided. Sites of interest for substitutional mutagenesis include the HVRs and FRs. Amino acid substitutions may be introduced into an antibody moiety of interest and the products screened for a desired activity, e.g., retained/improved antigen binding, decreased immunogenicity, or improved ADCC or CDC.
[0432] Conservative substitutions are shown in Table 5 below.
TABLE 5: CONSERVATIVE SUBSTITITIONS
He (I) Leu; Val; Met; Ala; Phe; Norleucine Leu
Leu (L) Norleucine; He; Val; Met; Ala; Phe He
Lys (K) Arg; Gin; Asn Arg
Met (M) Leu; Phe; He Leu
Phe (F) Trp; Leu; Val; He; Ala; Tyr Tyr
Pro (P) Ala Ala
Ser (S) Thr Thr
Thr (T) Val; Ser Ser
Trp (W) Tyr; Phe Tyr
Tyr (Y) Trp; Phe; Thr; Ser Phe
Val (V) He; Leu; Met; Phe; Ala; Norleucine Leu
[0433] Amino acids may be grouped into different classes according to common side-chain properties:
a. hydrophobic: Norleucine, Met, Ala, Val, Leu, He;
b. neutral hydrophilic: Cys, Ser, Thr, Asn, Gin;
c. acidic: Asp, Glu;
d. basic: His, Lys, Arg;
e. residues that influence chain orientation: Gly, Pro;
f. aromatic: Trp, Tyr, Phe.
[0434] Non-conservative substitutions will entail exchanging a member of one of these classes for another class.
[0435] An exemplary substitutional variant is an affinity matured antibody moiety, which may be conveniently generated, e.g., using phage display-based affinity maturation techniques. Briefly, one or more CDR residues are mutated and the variant antibody moieties displayed on phage and screened for a particular biological activity (e.g. binding affinity). Alterations (e.g., substitutions) may be made in HVRs, e.g., to improve antibody moiety affinity. Such alterations may be made in HVR "hotspots," i.e., residues encoded by codons that undergo mutation at high frequency during the somatic maturation process (see, e.g., Chowdhury, Methods Mol. Biol. 207: 179-196 (2008)), and/or specificity determining residues (SDRs), with the resulting variant VH or VL being tested for binding affinity.
Affinity maturation by constructing and reselecting from secondary libraries has been
described, e.g., in Hoogenboom et al. in Methods in Molecular Biology 178: 1-37 (O'Brien et ah, ed., Human Press, Totowa, NJ, (2001).)
[0436] In some embodiments of affinity maturation, diversity is introduced into the variable genes chosen for maturation by any of a variety of methods (e.g., error-prone PCR, chain shuffling, or oligonucleotide-directed mutagenesis). A secondary library is then created. The library is then screened to identify any antibody moiety variants with the desired affinity. Another method to introduce diversity involves HVR-directed approaches, in which several HVR residues (e.g., 4-6 residues at a time) are randomized. HVR residues involved in antigen binding may be specifically identified, e.g., using alanine scanning mutagenesis or modeling. CDR-H3 and CDR-L3 in particular are often targeted.
[0437] In some embodiments, substitutions, insertions, or deletions may occur within one or more HVRs so long as such alterations do not substantially reduce the ability of the antibody moiety to bind antigen. For example, conservative alterations (e.g., conservative substitutions as provided herein) that do not substantially reduce binding affinity may be made in HVRs. Such alterations may be outside of HVR "hotspots" or SDRs. In some embodiments of the variant VH and VL sequences provided above, each HVR either is unaltered, or contains no more than one, two or three amino acid substitutions.
[0438] A useful method for identification of residues or regions of an antibody moiety that may be targeted for mutagenesis is called "alanine scanning mutagenesis" as described by Cunningham and Wells (1989) Science, 244: 1081-1085. In this method, a residue or group of target residues (e.g., charged residues such as arg, asp, his, lys, and glu) are identified and replaced by a neutral or negatively charged amino acid (e.g., alanine or polyalanine) to determine whether the interaction of the antibody moiety with antigen is affected. Further substitutions may be introduced at the amino acid locations demonstrating functional sensitivity to the initial substitutions. Alternatively, or additionally, a crystal structure of an antigen-antibody moiety complex can be determined to identify contact points between the antibody moiety and antigen. Such contact residues and neighboring residues may be targeted or eliminated as candidates for substitution. Variants may be screened to determine whether they contain the desired properties.
[0439] Amino acid sequence insertions include amino- and/or carboxyl-terminal fusions ranging in length from one residue to polypeptides containing a hundred or more residues, as well as intrasequence insertions of single or multiple amino acid residues. Examples of terminal insertions include an antibody moiety with an N-terminal methionyl residue. Other
insertional variants of the antibody moiety include the fusion to the N- or C-terminus of the antibody moiety to an enzyme (e.g. for ADEPT) or a polypeptide which increases the serum half-life of the antibody moiety.
Fc Region Variants
[0440] In some embodiments, one or more amino acid modifications may be introduced into the Fc region of a full-length anti-E7MC antibody provided herein, thereby generating an Fc region variant. In some embodiments, the Fc region variant has enhanced antibody dependent cellular cytotoxicity (ADCC) effector function, often related to binding to Fc receptors (FcRs). In some embodiments, the Fc region variant has decreased ADCC effector function. There are many examples of changes or mutations to Fc sequences that can alter effector function. For example, WO 00/42072 and Shields et al. J Biol. Chem. 9(2): 6591- 6604 (2001) describe antibody variants with improved or diminished binding to FcRs. The contents of those publications are specifically incorporated herein by reference.
[0441] Antibody-Dependent Cell-Mediated Cytotoxicity (ADCC) is a mechanism of action of therapeutic antibodies against tumor cells. ADCC is a cell-mediated immune defense whereby an effector cell of the immune system actively lyses a target cell (e.g., a cancer cell), whose membrane-surface antigens have been bound by specific antibodies (e.g., an anti- E7MC antibody). The typical ADCC involves activation of NK cells by antibodies. An NK cell expresses CD16 which is an Fc receptor. This receptor recognizes, and binds to, the Fc portion of an antibody bound to the surface of a target cell. The most common Fc receptor on the surface of an NK cell is called CD 16 or FcyRIII. Binding of the Fc receptor to the Fc region of an antibody results in NK cell activation, release of cytolytic granules and consequent target cell apoptosis. The contribution of ADCC to tumor cell killing can be measured with a specific test that uses NK-92 cells that have been transfected with a high- affinity FcR. Results are compared to wild-type NK-92 cells that do not express the FcR.
[0442] In some embodiments, the invention contemplates an anti-E7MC construct variant comprising an FC region that possesses some but not all effector functions, which makes it a desirable candidate for applications in which the half-life of the anti-E7MC construct in vivo is important yet certain effector functions (such as CDC and ADCC) are unnecessary or deleterious. In vitro and/or in vivo cytotoxicity assays can be conducted to confirm the reduction/depletion of CDC and/or ADCC activities. For example, Fc receptor (FcR) binding assays can be conducted to ensure that the antibody lacks FcyR binding (hence likely lacking
ADCC activity), but retains FcRn binding ability. The primary cells for mediating ADCC, NK cells, express FcyRIII only, whereas monocytes express FcyRI, FcyRII and FcyRIII. FcR expression on hematopoietic cells is summarized in Table 3 on page 464 of Ravetch and Kinet, Annu. Rev. Immunol. 9:457-492 (1991). Non-limiting examples of in vitro assays to assess ADCC activity of a molecule of interest is described in U.S. Pat. No. 5,500,362 (see, e.g. Hellstrom, I. et al. Proc. Nat'l Acad. Sci. USA 83:7059-7063 (1986)) and Hellstrom, I et al, Proc. Nat'lAcad. Sci. USA 82: 1499-1502 (1985); U.S. Pat. No. 5,821,337 (see
Bruggemann, M. et al., J. Exp. Med. 166: 1351-1361 (1987)). Alternatively, non-radioactive assay methods may be employed (see, for example, ACTI™ non-radioactive cytotoxicity assay for flow cytometry (CellTechnology, Inc. Mountain View, Calif.; and CytoTox 96™ non-radioactive cytotoxicity assay (Promega, Madison, Wis.). Useful effector cells for such assays include peripheral blood mononuclear cells (PBMC) and Natural Killer (NK) cells. Alternatively, or additionally, ADCC activity of the molecule of interest may be assessed in vivo, e.g., in an animal model such as that disclosed in Clynes et al. Proc. Nat'lAcad. Sci. USA 95:652-656 (1998). Clq binding assays may also be carried out to confirm that the antibody is unable to bind Clq and hence lacks CDC activity. See, e.g., Clq and C3c binding ELISA in WO 2006/029879 and WO 2005/100402. To assess complement activation, a CDC assay may be performed (see, for example, Gazzano-Santoro et al., J. Immunol. Methods 202: 163 (1996); Cragg, M. S. et al, Blood 101: 1045-1052 (2003); and Cragg, M. S. and M. J. Glennie, Blood 103:2738-2743 (2004)). FcRn binding and in vivo clearance/half life determinations can also be performed using methods known in the art (see, e.g., Petkova, S. B. et al, Int'l. Immunol. 18(12): 1759-1769 (2006)).
[0443] Antibodies with reduced effector function include those with substitution of one or more of Fc region residues 238, 265, 269, 270, 297, 327 and 329 (U.S. Pat. No. 6,737,056). Such Fc mutants include Fc mutants with substitutions at two or more of amino acid positions 265, 269, 270, 297 and 327, including the so-called "DANA" Fc mutant with substitution of residues 265 and 297 to alanine (U.S. Pat. No. 7,332,581).
[0444] Certain antibody variants with improved or diminished binding to FcRs are described. (See, e.g., U.S. Pat. No. 6,737,056; WO 2004/056312, and Shields et al, J. Biol. Chem. 9(2): 6591-6604 (2001).)
[0445] In some embodiments, there is provided an anti-E7MC construct {e.g., a full-length anti-E7MC antibody) variant comprising a variant Fc region comprising one or more amino acid substitutions which improve ADCC. In some embodiments, the variant Fc region
comprises one or more amino acid substitutions which improve ADCC, wherein the substitutions are at positions 298, 333, and/or 334 of the variant Fc region (EU numbering of residues). In some embodiments, the anti-E7MC construct (e.g., full-length anti-E7MC antibody) variant comprises the following amino acid substitution in its variant Fc region: S298A, E333A, and K334A.
[0446] In some embodiments, alterations are made in the Fc region that result in altered (i.e., either improved or diminished) Clq binding and/or Complement Dependent
Cytotoxicity (CDC), e.g., as described in U.S. Pat. No. 6,194,551, WO 99/51642, and Idusogie et al, J. Immunol. 164: 4178-4184 (2000).
[0447] In some embodiments, there is provided an anti-E7MC construct (e.g., a full-length anti-E7MC antibody) variant comprising a variant Fc region comprising one or more amino acid substitutions which increase half-life and/or improve binding to the neonatal Fc receptor (FcRn). Antibodies with increased half-lives and improved binding to FcRn are described in US2005/0014934A1 (Hinton et ah). Those antibodies comprise an Fc region with one or more substitutions therein which improve binding of the Fc region to FcRn. Such Fc variants include those with substitutions at one or more of Fc region residues: 238, 256, 265, 272, 286, 303, 305, 307, 311, 312, 317, 340, 356, 360, 362, 376, 378, 380, 382, 413, 424 or 434, e.g., substitution of Fc region residue 434 (U.S. Pat. No. 7,371,826).
[0448] See also Duncan & Winter, Nature 322:738-40 (1988); U.S. Pat. No. 5,648,260; U.S. Pat. No. 5,624,821; and WO 94/29351 concerning other examples of Fc region variants.
[0449] Anti-E7MC constructs (such as full-length anti-E7MC antibodies) comprising any of the Fc variants described herein, or combinations thereof, are contemplated.
Glycosylation Variants
[0450] In some embodiments, an anti-E7MC construct provided herein is altered to increase or decrease the extent to which the anti-E7MC construct is glycosylated. Addition or deletion of glycosylation sites to an anti-E7MC construct may be conveniently accomplished by altering the amino acid sequence of the anti-E7MC construct or polypeptide portion thereof such that one or more glycosylation sites is created or removed.
[0451] Where the anti-E7MC construct comprises an Fc region, the carbohydrate attached thereto may be altered. Native antibodies produced by mammalian cells typically comprise a branched, biantennary oligosaccharide that is generally attached by an N-linkage to Asn297 of the CH2 domain of the Fc region. See, e.g., Wright et al, TIBTECH 15:26-32 (1997). The
oligosaccharide may include various carbohydrates, e.g., mannose, N-acetyl glucosamine (GlcNAc), galactose, and sialic acid, as well as a fucose attached to a GlcNAc in the "stem" of the biantennary oligosaccharide structure. In some embodiments, modifications of the oligosaccharide in an anti-E7MC construct of the invention may be made in order to create anti-E7MC construct variants with certain improved properties.
[0452] In some embodiments, anti-E7MC construct (such as full-length anti-E7MC antibody) variants are provided comprising an Fc region wherein a carbohydrate structure attached to the Fc region has reduced fucose or lacks fucose, which may improve ADCC function. Specifically, anti-E7MC constructs are contemplated herein that have reduced fusose relative to the amount of fucose on the same anti-E7MC construct produced in a wild- type CHO cell. That is, they are characterized by having a lower amount of fucose than they would otherwise have if produced by native CHO cells (e.g., a CHO cell that produce a native glycosylation pattern, such as, a CHO cell containing a native FUT8 gene). In some embodiments, the anti-E7MC construct is one wherein less than about 50%, 40%, 30%, 20%, 10%, or 5% of the N-linked glycans thereon comprise fucose. For example, the amount of fucose in such an anti-E7MC construct may be from 1% to 80%, from 1% to 65%, from 5% to 65% or from 20% to 40%. In some embodiments, the anti-E7MC construct is one wherein none of the N-linked glycans thereon comprise fucose, i.e., wherein the anti-E7MC construct is completely without fucose, or has no fucose or is afucosylated. The amount of fucose is determined by calculating the average amount of fucose within the sugar chain at Asn297, relative to the sum of all glycostructures attached to Asn 297 (e. g. complex, hybrid and high mannose structures) as measured by MALDI-TOF mass spectrometry, as described in WO 2008/077546, for example. Asn297 refers to the asparagine residue located at about position 297 in the Fc region (Eu numbering of Fc region residues); however, Asn297 may also be located about +3 amino acids upstream or downstream of position 297, i.e., between positions 294 and 300, due to minor sequence variations in antibodies. Such fucosylation variants may have improved ADCC function. See, e.g., US Patent Publication Nos. US 2003/0157108 (Presta, L.); US 2004/0093621 (Kyowa Hakko Kogyo Co., Ltd). Examples of publications related to "defucosylated" or "fucose-deficient" antibody variants include: US 2003/0157108; WO 2000/61739; WO 2001/29246; US 2003/0115614; US 2002/0164328; US
2004/0093621; US 2004/0132140; US 2004/0110704; US 2004/0110282; US 2004/0109865; WO 2003/085119; WO 2003/084570; WO 2005/035586; WO 2005/035778;
WO2005/053742; WO2002/031140; Okazaki et al J. Mol. Biol. 336: 1239-1249 (2004);
Yamane-Ohnuki et al. Biotech. Bioeng. 87: 614 (2004). Examples of cell lines capable of producing defucosylated antibodies include Led 3 CHO cells deficient in protein
fucosylation (Ripka et al. Arch. Biochem. Biophys. 249:533-545 (1986); US Pat Appl No US 2003/0157108 Al, Presta, L; and WO 2004/056312 Al, Adams et al, especially at Example 11), and knockout cell lines, such asa-l,6-fucosyltransferase gene, FUT8, knockout CHO cells (see, e.g., Yamane-Ohnuki et al. Biotech. Bioeng. 87: 614 (2004); Kanda, Y. et al., Biotechnol. Bioeng., 94(4):680-688 (2006); and WO2003/085107).
[0453] Anti-E7MC construct (such as full-length anti-E7MC antibody) variants are further provided with bisected oligosaccharides, e.g., in which a biantennary oligosaccharide attached to the Fc region of the anti-E7MC construct is bisected by GlcNAc. Such anti- E7MC construct (such as full-length anti-E7MC antibody) variants may have reduced fucosylation and/or improved ADCC function. Examples of such antibody variants are described, e.g., in WO 2003/011878 (Jean-Mairet et al); U.S. Pat. No. 6,602,684 (Umana et al); US 2005/0123546 (Umana et al), and Ferrara et al, Biotechnology and Bioengineering, 93(5): 851-861 (2006). Anti-E7MC construct (such as full-length anti-E7MC antibody) variants with at least one galactose residue in the oligosaccharide attached to the Fc region are also provided. Such anti-E7MC construct variants may have improved CDC function. Such antibody variants are described, e.g., in WO 1997/30087 (Patel et al); WO 1998/58964 (Raju, S.); and WO 1999/22764 (Raju, S.).
[0454] In some embodiments, the anti-E7MC construct (such as full-length anti-E7MC antibody) variants comprising an Fc region are capable of binding to an FcyRIII. In some embodiments, the anti-E7MC construct (such as full-length anti-E7MC antibody) variants comprising an Fc region have ADCC activity in the presence of human effector cells or have increased ADCC activity in the presence of human effector cells compared to the otherwise same anti-E7MC construct (such as full-length anti-E7MC antibody) comprising a human wild-type IgGlFc region.
Cysteine Engineered Variants
[0455] In some embodiments, it may be desirable to create cysteine engineered anti-E7MC constructs (such as full-length anti-E7MC antibodies) in which one or more amino acid residues are substituted with cysteine residues. In some embodiments, the substituted residues occur at accessible sites of the anti-E7MC construct. By substituting those residues with cysteine, reactive thiol groups are thereby positioned at accessible sites of the anti-E7MC
construct and may be used to conjugate the anti-E7MC construct to other moieties, such as drug moieties or linker-drug moieties, to create an anti-E7MC immunoconjugate, as described further herein. Cysteine engineered anti-E7MC constructs (such as full-length anti- E7MC antibodies) may be generated as described, e.g., in U.S. Pat. No. 7,521,541.
Derivatives
[0456] In some embodiments, an anti-E7MC construct provided herein may be further modified to contain additional nonproteinaceous moieties that are known in the art and readily available. The moieties suitable for derivatization of the anti-E7MC construct include but are not limited to water soluble polymers. Non-limiting examples of water soluble polymers include, but are not limited to, polyethylene glycol (PEG), copolymers of ethylene glycol/propylene glycol, carboxymethylcellulose, dextran, polyvinyl alcohol, polyvinyl pyrrolidone, poly-l,3-dioxolane, poly-l,3,6-trioxane, ethylene/maleic anhydride copolymer, polyaminoacids (either homopolymers or random copolymers), and dextran or poly(n- vinyl pyrrolidone)polyethylene glycol, propropylene glycol homopolymers, prolypropylene oxide/ethylene oxide co-polymers, polyoxyethylated polyols (e.g., glycerol), polyvinyl alcohol, and mixtures thereof. Polyethylene glycol propionaldehyde may have advantages in manufacturing due to its stability in water. The polymer may be of any molecular weight, and may be branched or unbranched. The number of polymers attached to the anti-E7MC construct may vary, and if more than one polymer are attached, they can be the same or different molecules. In general, the number and/or type of polymers used for derivatization can be determined based on considerations including, but not limited to, the particular properties or functions of the anti-E7MC construct to be improved, whether the anti-E7MC construct derivative will be used in a therapy under defined conditions, etc.
[0457] In some embodiments, conjugates of an anti-E7MC construct and nonproteinaceous moiety that may be selectively heated by exposure to radiation are provided. In some embodiments, the nonproteinaceous moiety is a carbon nanotube (Kam et ah, Proc. Natl. Acad. Sci. USA 102: 11600-11605 (2005)). The radiation may be of any wavelength, and includes, but is not limited to, wavelengths that do not harm ordinary cells, but which heat the nonproteinaceous moiety to a temperature at which cells proximal to the anti-E7MC construct-nonproteinaceous moiety are killed.
CAR Effector Cell Preparation
[0458] The present invention in one aspect provides effector cells (such as lymphocytes, for example T cells) expressing an anti-E7MC CAR. Exemplary methods of preparing effector cells (such as T cells) expressing the anti-E7MC CARs (anti-E7MC CAR effector cells, such as anti-E7MC CAR T cells) are provided herein.
[0459] In some embodiments, an anti-E7MC CAR effector cell (such as T cell) can be generated by introducing a vector (including for example a lentiviral vector) comprising an anti-E7MC CAR (for example a CAR comprising an anti-E7MC antibody moiety and CD28 and CD3ζ intracellular signaling sequences) into the effector cell (such as T cell). In some embodiments, the anti-E7MC CAR effector cells (such as T cells) of the invention are able to replicate in vivo, resulting in long-term persistence that can lead to sustained control of an HPV16-E7-positive disease (such as cancer, e.g., squamous cell carcinoma, cervical cancer, or anal cancer).
[0460] In some embodiments, the invention relates to administering a genetically modified T cell expressing an anti-E7MC CAR for the treatment of a patient having an HPV16-E7- positive disease or at risk of having an HPV16-E7-positive disease using lymphocyte infusion. In some embodiments, autologous lymphocyte infusion is used in the treatment. Autologous PBMCs are collected from a patient in need of treatment and T cells are activated and expanded using the methods described herein and known in the art and then infused back into the patient.
[0461] In some embodiments, the anti-E7MC CAR T cell expresses an anti-E7MC CAR comprising an anti-E7MC antibody moiety (also referred to herein as an "anti-E7MC CAR T cell"). In some embodiments, the anti-E7MC CAR T cell expresses an anti-E7MC CAR comprising an extracellular domain comprising an anti-E7MC antibody moiety and an intracellular domain comprising intracellular signaling sequences of CD3ζ and CD28. The anti-E7MC CAR T cells of the invention can undergo robust in vivo T cell expansion and can establish E7MC-specific memory cells that persist at high levels for an extended amount of time in blood and bone marrow. In some embodiments, the anti-E7MC CAR T cells of the invention infused into a patient can eliminate E7MC-presenting cells, such as E7MC- presenting cancer cells, in vivo in patients having an HPV16-E7-positive disease. In some embodiments, the anti-E7MC CAR T cells of the invention infused into a patient can eliminate E7MC-presenting cells, such as E7MC-presenting cancer cells, in vivo in patients having an HPV16-E7-positive disease that is refractory to at least one conventional treatment.
[0462] Prior to expansion and genetic modification of the T cells, a source of T cells is obtained from a subject. T cells can be obtained from a number of sources, including peripheral blood mononuclear cells, bone marrow, lymph node tissue, cord blood, thymus tissue, tissue from a site of infection, ascites, pleural effusion, spleen tissue, and tumors. In some embodiments of the present invention, any number of T cell lines available in the art may be used. In some embodiments of the present invention, T cells can be obtained from a unit of blood collected from a subject using any number of techniques known to the skilled artisan, such as Ficoll™ separation. In some embodiments, cells from the circulating blood of an individual are obtained by apheresis. The apheresis product typically contains
lymphocytes, including T cells, monocytes, granulocytes, B cells, other nucleated white blood cells, red blood cells, and platelets. In some embodiments, the cells collected by apheresis may be washed to remove the plasma fraction and to place the cells in an appropriate buffer or media for subsequent processing steps. In some embodiments, the cells are washed with phosphate buffered saline (PBS). In some embodiments, the wash solution lacks calcium and may lack magnesium or may lack many if not all divalent cations. As those of ordinary skill in the art would readily appreciate a washing step may be accomplished by methods known to those in the art, such as by using a semi-automated "flow-through" centrifuge (for example, the Cobe 2991 cell processor, the Baxter CytoMate, or the
Haemonetics Cell Saver 5) according to the manufacturer's instructions. After washing, the cells may be resuspended in a variety of biocompatible buffers, such as Ca2+-free, Mg2+-free PBS, PlasmaLyte A, or other saline solutions with or without buffer. Alternatively, the undesirable components of the apheresis sample may be removed and the cells directly resuspended in culture media.
[0463] In some embodiments, T cells are isolated from peripheral blood lymphocytes by lysing the red blood cells and depleting the monocytes, for example, by centrifugation through a PERCOLL™ gradient or by counterflow centrifugal elutriation. A specific subpopulation of T cells, such as CD3+, CD28+, CD4+, CD8+, CD45RA+, and CD45RO+ T cells, can be further isolated by positive or negative selection techniques. For example, in some embodiments, T cells are isolated by incubation with anti-CD3/anti-CD28 (i.e., 3x28)- conjugated beads, such as DYNABEADS® M-450 CD3/CD28 T, for a time period sufficient for positive selection of the desired T cells. In some embodiments, the time period is about 30 minutes. In some embodiments, the time period ranges from 30 minutes to 36 hours or longer and all integer values there between. In some embodiments, the time period is at least one, 2,
3, 4, 5, or 6 hours. In some embodiments, the time period is 10 to 24 hours. In some embodiments, the incubation time period is 24 hours. For isolation of T cells from patients with leukemia, use of longer incubation times, such as 24 hours, can increase cell yield. Longer incubation times may be used to isolate T cells in any situation where there are few T cells as compared to other cell types, such as in isolating tumor infiltrating lymphocytes (TIL) from tumor tissue or from immune-compromised individuals. Further, use of longer incubation times can increase the efficiency of capture of CD8+ T cells. Thus, by simply shortening or lengthening the time T cells are allowed to bind to the CD3/CD28 beads and/or by increasing or decreasing the ratio of beads to T cells, subpopulations of T cells can be preferentially selected for or against at culture initiation or at other time points during the process. Additionally, by increasing or decreasing the ratio of anti-CD3 and/or anti-CD28 antibodies on the beads or other surface, subpopulations of T cells can be preferentially selected for or against at culture initiation or at other desired time points. The skilled artisan would recognize that multiple rounds of selection can also be used in the context of this invention. In some embodiments, it may be desirable to perform the selection procedure and use the "unselected" cells in the activation and expansion process. "Unselected" cells can also be subjected to further rounds of selection.
[0464] Enrichment of a T cell population by negative selection can be accomplished with a combination of antibodies directed to surface markers unique to the negatively selected cells. One method is cell sorting and/or selection via negative magnetic immunoadherence or flow cytometry that uses a cocktail of monoclonal antibodies directed to cell surface markers present on the cells negatively selected. For example, to enrich for CD4+ cells by negative selection, a monoclonal antibody cocktail typically includes antibodies to CD 14, CD20, CD1 lb, CD 16, HLA-DR, and CD8. In some embodiments, it may be desirable to enrich for or positively select for regulatory T cells which typically express CD4+, CD25+, CD62Lhi, GITR+, and FoxP3+. Alternatively, in some embodiments, T regulatory cells are depleted by anti-CD25 conjugated beads or other similar methods of selection.
[0465] For isolation of a desired population of cells by positive or negative selection, the concentration of cells and surface (e.g. , particles such as beads) can be varied. In some embodiments, it may be desirable to significantly decrease the volume in which beads and cells are mixed together (i.e. , increase the concentration of cells), to ensure maximum contact of cells and beads. For example, in some embodiments, a concentration of about 2 billion cells/ml is used. In some embodiments, a concentration of about 1 billion cells/ml is used. In
some embodiments, greater than about 100 million cells/ml is used. In some embodiments, a concentration of cells of about any of 10, 15, 20, 25, 30, 35, 40, 45, or 50 million cells/ml is used. In some embodiments, a concentration of cells of about any of 75, 80, 85, 90, 95, or 100 million cells/ml is used. In some embodiments, a concentration of about 125 or about 150 million cells/ml is used. Using high concentrations can result in increased cell yield, cell activation, and cell expansion. Further, use of high cell concentrations allows more efficient capture of cells that may weakly express target antigens of interest, such as CD28-negative T cells, or from samples where there are many tumor cells present (i.e., leukemic blood, tumor tissue, etc.). Such populations of cells may have therapeutic value and would be desirable to obtain. For example, using high concentration of cells allows more efficient selection of CD8+ T cells that normally have weaker CD28 expression.
[0466] In some embodiments of the present invention, T cells are obtained from a patient directly following treatment. In this regard, it has been observed that following certain cancer treatments, in particular treatments with drugs that damage the immune system, shortly after treatment during the period when patients would normally be recovering from the treatment, the quality of T cells obtained may be optimal or improved for their ability to expand ex vivo. Likewise, following ex vivo manipulation using the methods described herein, these cells may be in a preferred state for enhanced engraftment and in vivo expansion. Thus, it is
contemplated within the context of the present invention to collect blood cells, including T cells, dendritic cells, or other cells of the hematopoietic lineage, during this recovery phase. Further, in some embodiments, mobilization (for example, mobilization with GM-CSF) and conditioning regimens can be used to create a condition in a subject wherein repopulation, recirculation, regeneration, and/or expansion of particular cell types is favored, especially during a defined window of time following therapy. Illustrative cell types include T cells, B cells, dendritic cells, and other cells of the immune system.
[0467] Whether prior to or after genetic modification of the T cells to express a desirable anti-E7MC CAR, the T cells can be activated and expanded generally using methods as described, for example, in U.S. Pat. Nos. 6,352,694; 6,534,055; 6,905,680; 6,692,964;
5,858,358; 6,887,466; 6,905,681; 7,144,575; 7,067,318; 7,172,869; 7,232,566; 7,175,843; 5,883,223; 6,905,874; 6,797,514; 6,867,041; and U.S. Patent Application Publication No. 20060121005.
[0468] Generally, the T cells of the invention are expanded by contact with a surface having attached thereto an agent that stimulates a CD3/TCR complex associated signal and a
ligand that stimulates a co-stimulatory molecule on the surface of the T cells. In particular, T cell populations may be stimulated, such as by contact with an anti-CD3 antibody, or antigen- binding fragment thereof, or an anti-CD2 antibody immobilized on a surface, or by contact with a protein kinase C activator (e.g., bryostatin) in conjunction with a calcium ionophore. For co-stimulation of an accessory molecule on the surface of the T cells, a ligand that binds the accessory molecule is used. For example, a population of T cells can be contacted with an anti-CD3 antibody and an anti-CD28 antibody, under conditions appropriate for stimulating proliferation of the T cells. To stimulate proliferation of either CD4+ T cells or CD8+ T cells, an anti-CD3 antibody and an anti-CD28 antibody. Examples of an anti-CD28 antibody include 9.3, B-T3, XR-CD28 (Diaclone, Besancon, France) can be used as can other methods commonly known in the art (Berg et al., Transplant P roc. 30(8):3975-3977, 1998; Haanen et al, J. Exp. Med. 190(9): 13191328, 1999; Garland et al., J. Immunol. Meth. 227(l-2):53-63, 1999).
Immunoconjugate preparation
[0469] The anti-E7MC immunoconjugates may be prepared using any methods known in the art. See, e.g., WO 2009/067800, WO 2011/133886, and U.S. Patent Application
Publication No. 2014322129, incorporated by reference herein in their entirety.
[0470] The anti-E7MC antibody moiety of an anti-E7MC immunoconjugate may be "attached to" the effector molecule by any means by which the anti-E7MC antibody moiety can be associated with, or linked to, the effector molecule. For example, the anti-E7MC antibody moiety of an anti-E7MC immunoconjugate may be attached to the effector molecule by chemical or recombinant means. Chemical means for preparing fusions or conjugates are known in the art and can be used to prepare the anti-E7MC immunoconjugate. The method used to conjugate the anti-E7MC antibody moiety and effector molecule must be capable of joining the binding protein with the effector molecule without interfering with the ability of the binding protein to bind to the antigen on the target cell.
[0471] The anti-E7MC antibody moiety of an anti-E7MC immunoconjugate may be linked indirectly to the effector molecule. For example, the anti-E7MC antibody moiety of an anti- E7MC immunoconjugate may be directly linked to a liposome containing the effector molecule of one of several types. The effector molecule(s) and/or the anti-E7MC antibody moiety may also be bound to a solid surface.
[0472] In some embodiments, the anti-E7MC antibody moiety of an anti-E7MC
immunoconjugate and the effector molecule are both proteins and can be conjugated using techniques well known in the art. There are several hundred crosslinkers available that can conjugate two proteins. (See for example "Chemistry of Protein Conjugation and
Crosslinking". 1991 , Shans Wong, CRC Press, Ann Arbor). The crosslinker is generally chosen based on the reactive functional groups available or inserted on the anti-E7MC antibody moiety and/or effector molecule. In addition, if there are no reactive groups, a photoactivatible crosslinker can be used. In certain instances, it may be desirable to include a spacer between the anti-E7MC antibody moiety and the effector molecule. Crosslinking agents known to the art include the homobifunctional agents: glutaraldehyde,
dimethyladipimidate and Bis(diazobenzidine) and the heterobifunctional agents: m
Maleimidobenzoyl-N-Hydroxysuccinimide and Sulfo-m Maleimidobenzoyl-N- Hydroxysuccinimide.
[0473] In some embodiments, the anti-E7MC antibody moiety of an anti-E7MC
immunoconjugate may be engineered with specific residues for chemical attachment of the effector molecule. Specific residues used for chemical attachment of molecule known to the art include lysine and cysteine. The crosslinker is chosen based on the reactive functional groups inserted on the anti-E7MC antibody moiety, and available on the effector molecule.
[0474] An anti-E7MC immunoconjugate may also be prepared using recombinant DNA techniques. In such a case a DNA sequence encoding the anti-E7MC antibody moiety is fused to a DNA sequence encoding the effector molecule, resulting in a chimeric DNA molecule. The chimeric DNA sequence is transfected into a host cell that expresses the fusion protein. The fusion protein can be recovered from the cell culture and purified using techniques known in the art.
[0475] Examples of attaching an effector molecule, which is a label, to the binding protein include the methods described in Hunter, et al., Nature 144:945 (1962); David, et al., Biochemistry 13: 1014 (1974); Pain, et al, J. Immunol. Meth. 40:219 (1981); Nygren, J. Histochem. and Cytochem. 30:407 (1982); Wensel and Meares, Radioimmunoimaging And Radioimmunotherapy, Elsevier, N.Y. (1983); and Colcher et al, "Use Of Monoclonal Antibodies As Radiopharmaceuticals For The Localization Of Human Carcinoma Xenografts In Athymic Mice", Meth. Enzymol., 121:802-16 (1986).
[0476] The radio- or other labels may be incorporated in the immunoconjugate in known ways. For example, the peptide may be biosynthesized or may be synthesized by chemical
amino acid synthesis using suitable amino acid precursors involving, for example, fluorine- 19 in place of hydrogen. Labels such as 99Tc or 123I, 186Re, 188Re and luIn can be attached via a cysteine residue in the peptide. Yttrium-90 can be attached via a lysine residue. The
IODOGEN method (Fraker et ah, Biochem. Biophys. Res. Commun. 80:49-57 (1978)) can be used to incorporate iodine- 123. "Monoclonal Antibodies in Immuno scintigraphy" (Chatal, CRC Press 1989) describes other methods in detail.
[0477] Immunoconjugates of the antibody moiety and a cytotoxic agent may be made using a variety of bifunctional protein coupling agents such as N-succinimidyl-3-(2-pyridyldithio) propionate (SPDP), succinimidyl-4-(N-maleimidomethyl) cyclohexane- 1 -carboxylate (SMCC), iminothiolane (IT), bifunctional derivatives of imidoesters (such as dimethyl adipimidate HCI), active esters (such as disuccinimidyl suberate), aldehydes (such as glutaraldehyde), bis-azido compounds (such as bis (p-azidobenzoyl) hexanediamine), bis- diazonium derivatives (such as bis-(p-diazoniumbenzoyl)- ethylenediamine), diisocyanates (such as toluene 2,6-diisocyanate), and bis-active fluorine compounds (such as 1 ,5-difluoro- 2,4-dinitrobenzene). For example, a ricin immunotoxin can be prepared as described in Vitetta et ah, Science 238: 1098 (1987). Carbon- 14-labeled l-isothiocyanatobenzyl-3- methyldiethylene tnaminepentaacetic acid (MX-DTPA) is an exemplary chelating agent for conjugation of radionucleotide to the antibody. See, e.g., W094/11026. The linker may be a "cleavable linker" facilitating release of the cytotoxic drug in the cell. For example, an acid- labile linker, peptidase- sensitive linker, photolabile linker, dimethyl linker or disulfide- containing linker (Chari et ah, Cancer Research 52: 127-131 (1992); U.S. Patent No.
5,208,020) may be used.
[0478] The anti-E7MC immunoconjugates of the invention expressly contemplate, but are not limited to, ADC prepared with cross-linker reagents: BMPS, EMCS, GMBS, HBVS, LC- SMCC, MBS, MPBH, SBAP, SIA, SIAB, SMCC, SMPB, SMPH, sulfo-EMCS, sulfo- GMBS, sulfo-KMUS, sulfo-MBS, sulfo-SIAB, sulfo-SMCC, and sulfo-SMPB, and SVSB (succinimidyl-(4-vinylsulfone)benzoate) which are commercially available {e.g., from Pierce Biotechnology, Inc., Rockford, IL, U.S.A). See pages 467-498, 2003-2004 Applications Handbook and Catalog.
Pharmaceutical Compositions
[0479] Also provided herein are compositions (such as pharmaceutical compositions, also referred to herein as formulations) comprising an anti-E7MC construct. In some
embodiments, the composition further comprises a cell (such as an effector cell, e.g., a T cell) associated with the anti-E7MC construct. In some embodiments, there is provided a pharmaceutical composition comprising an anti-E7MC construct and a pharmaceutically acceptable carrier. In some embodiments, the pharmaceutical composition further comprises a cell (such as an effector cell, e.g., a T cell) associated with the anti-E7MC construct.
[0480] Suitable formulations of the anti-E7MC constructs are obtained by mixing an anti- E7MC construct having the desired degree of purity with optional pharmaceutically acceptable carriers, excipients or stabilizers (Remington's Pharmaceutical Sciences 16th edition, Osol, A. Ed. (1980)), in the form of lyophilized formulations or aqueous solutions. Acceptable carriers, excipients, or stabilizers are nontoxic to recipients at the dosages and concentrations employed, and include buffers such as phosphate, citrate, and other organic acids; antioxidants including ascorbic acid and methionine; preservatives (such as
octadecyldimethylbenzyl ammonium chloride; hexamethonium chloride; benzalkonium chloride, benzethonium chloride; phenol, butyl or benzyl alcohol; alkyl parabens such as methyl or propylparaben; catechol; resorcinol; cyclohexanol; 3-pentanol; and m-cresol); low molecular weight (less than about 10 residues) polypeptides; proteins, such as serum albumin, gelatin, or immunoglobulins; hydrophilic polymers such as olyvinylpyrrolidone; amino acids such as glycine, glutamine, asparagine, histidine, arginine, or lysine; monosaccharides, disaccharides, and other carbohydrates including glucose, mannose, or dextrins; chelating agents such as EDTA; sugars such as sucrose, mannitol, trehalose or sorbitol; salt-forming counter- ions such as sodium; metal complexes (e.g. Zn-protein complexes); and/or non-ionic surfactants such as TWEEN™, PLURONICS™ or polyethylene glycol (PEG). Exemplary formulations are described in W098/56418, expressly incorporated herein by reference. Lyophilized formulations adapted for subcutaneous administration are described in
WO97/04801. Such lyophilized formulations may be reconstituted with a suitable diluent to a high protein concentration and the reconstituted formulation may be administered
subcutaneously to the individual to be treated herein. Lipofectins or liposomes can be used to deliver the anti-E7MC constructs of this invention into cells.
[0481] The formulation herein may also contain one or more active compounds in addition to the anti-E7MC construct as necessary for the particular indication being treated, preferably those with complementary activities that do not adversely affect each other. For example, it may be desirable to further provide an anti-neoplastic agent, a growth inhibitory agent, a cytotoxic agent, or a chemotherapeutic agent in addition to the anti-E7MC construct. Such
molecules are suitably present in combination in amounts that are effective for the purpose intended. The effective amount of such other agents depends on the amount of anti-E7MC construct present in the formulation, the type of disease or disorder or treatment, and other factors discussed above. These are generally used in the same dosages and with
administration routes as described herein or about from 1 to 99% of the heretofore employed dosages.
[0482] The anti-E7MC constructs may also be entrapped in microcapsules prepared, for example, by coacervation techniques or by interfacial polymerization, for example, hydroxymethylcellulose or gelatin-microcapsules and poly-(methylmethacylate)
microcapsules, respectively, in colloidal drug delivery systems (for example, liposomes, albumin microspheres, microemulsions, nano-particles and nanocapsules) or in
macroemulsions. Such techniques are disclosed in Remington's Pharmaceutical Sciences 16th edition, Osol, A. Ed. (1980). Sustained-release preparations may be prepared.
[0483] Sustained-release preparations of the anti-E7MC constructs can be prepared.
Suitable examples of sustained-release preparations include semipermeable matrices of solid hydrophobic polymers containing the antibody (or fragment thereof), which matrices are in the form of shaped articles, e.g., films, or microcapsules. Examples of sustained-release matrices include polyesters, hydro gels (for example, poly(2-hydroxyethyl-methacrylate ), or poly(vinylalcohol)), polylactides (U.S. Pat. No. 3,773,919), copolymers of L-glutamic acid and ethyl-L-glutamate, non-degradable ethylene-vinyl acetate, degradable lactic acid-glycolic acid copolymers such as the LUPRON DEPOT TM (injectable microspheres composed of lactic acid-glycolic acid copolymer and leuprolide acetate), and poly-D-(-)-3-hydroxybutyric acid. While polymers such as ethylene-vinyl acetate and lactic acid-glycolic acid enable release of molecules for over 100 days, certain hydro gels release proteins for shorter time periods. When encapsulated antibodies remain in the body for a long time, they can denature or aggregate as a result of exposure to moisture at 37°C, resulting in a loss of biological activity and possible changes in immunogenicity. Rational strategies can be devised for stabilization of anti-E7MC constructs depending on the mechanism involved. For example, if the aggregation mechanism is discovered to be intermolecular S-S bond formation through thio-disulfide interchange, stabilization can be achieved by modifying sulfhydryl residues, lyophilizing from acidic solutions, controlling moisture content, using appropriate additives, and developing specific polymer matrix compositions.
[0484] In some embodiments, the anti-E7MC construct is formulated in a buffer comprising a citrate, NaCl, acetate, succinate, glycine, polysorbate 80 (Tween 80), or any combination of the foregoing. In some embodiments, the anti-E7MC construct is formulated in a buffer comprising about 100 mM to about 150 mM glycine. In some embodiments, the anti-E7MC construct is formulated in a buffer comprising about 50mM to about 100 mM NaCl. In some embodiments, the anti-E7MC construct is formulated in a buffer comprising about lOmM to about 50 mM acetate. In some embodiments, the anti-E7MC construct is formulated in a buffer comprising about lOmM to about 50 mM succinate. In some embodiments, the anti-E7MC construct is formulated in a buffer comprising about 0.005% to about 0.02% polysorbate 80. In some embodiments, the anti-E7MC construct is formulated in a buffer having a pH between about 5.1 and 5.6. In some embodiments, the anti-E7MC construct is formulated in a buffer comprising 10 mM citrate, 100 mM NaCl, lOOmM glycine, and 0.01% polysorbate 80, wherein the formulation is at pH 5.5.
[0485] The formulations to be used for in vivo administration must be sterile. This is readily accomplished by, e.g., filtration through sterile filtration membranes.
Methods for treatment using anti-E7MC constructs
[0486] The anti-E7MC constructs and/or compositions of the invention can be administered to individuals (e.g., mammals such as humans) to treat a disease and/or disorder associated with HPV16-E7 expression (also referred to herein as an "HPV16-E7-positive" disease or disorder), including, for example, HPV16-E7-positive cancer (such as squamous cell carcinoma, cervical cancer, anal cancer, vaginal cancer, vulvar cancer, penile cancer, head and neck cancer, or oropharyngeal cancer). The present application thus in some
embodiments provides a method of treating an HPV16-E7-positive disease (such as cancer, e.g., squamous cell carcinoma) in an individual comprising administering to the individual an effective amount of a composition (such as a pharmaceutical composition) comprising an anti-E7MC construct comprising an anti-E7MC antibody moiety, such as any one of the anti- E7MC constructs described herein. In some embodiments, the composition further comprises a cell (such as an effector cell) associated with the anti-E7MC construct. In some
embodiments, the cancer is selected, for example, from the group consisting of squamous cell carcinoma, cervical cancer, anal cancer, vaginal cancer, vulvar cancer, penile cancer, head and neck cancer, or oropharyngeal cancer.
[0487] For example, in some embodiments, there is provided a method of treating an HPV16-E7-positive disease in an individual comprising administering to the individual an effective amount of a composition comprising an anti-E7MC construct comprising an anti- E7MC antibody moiety that specifically binds to a complex comprising an HPV16-E7 peptide and an MHC class I protein. In some embodiments, the HPV16-E7 peptide is HPV16-E7 11-19 (SEQ ID NO: 4). In some embodiments, the MHC class I protein is HLA- A02. In some embodiments, the MHC class I protein is HLA-A*02:01. In some
embodiments, the anti-E7MC construct is non-naturally occurring. In some embodiments, the anti-E7MC construct is a full-length antibody. In some embodiments, the anti-E7MC construct is a multi- specific (such as bispecific) molecule. In some embodiments, the anti- E7MC construct is a chimeric antigen receptor. In some embodiments, the anti-E7MC construct is an immunoconjugate. In some embodiments, the composition further comprises a cell (such as an effector cell) associated with the anti-E7MC construct. In some
embodiments, the HPV16-E7-positive disease is cancer. In some embodiments, the cancer is, for example, squamous cell carcinoma, cervical cancer, anal cancer, vaginal cancer, vulvar cancer, penile cancer, head and neck cancer, or oropharyngeal cancer. In some embodiments, the cancer is an HPV16-E7-positive squamous cell carcinoma. In some embodiments, the individual is human.
[0488] In some embodiments, there is provided a method of treating an HPV16-E7 -positive disease in an individual comprising administering to the individual an effective amount of a composition comprising an anti-E7MC construct comprising an anti-E7MC antibody moiety that specifically binds to a complex comprising an HPV16-E7 11-19 peptide (SEQ ID NO: 4) and HLA-A*02:01. In some embodiments, the anti-E7MC construct is non-naturally occurring. In some embodiments, the anti-E7MC construct is a full-length antibody. In some embodiments, the anti-E7MC construct is a multi- specific (such as bispecific) molecule. In some embodiments, the anti-E7MC construct is a chimeric antigen receptor. In some embodiments, the anti-E7MC construct is an immunoconjugate. In some embodiments, the composition further comprises a cell (such as an effector cell) associated with the anti-E7MC construct. In some embodiments, the HPV16-E7-positive disease is cancer. In some embodiments, the cancer is, for example, squamous cell carcinoma, cervical cancer, anal cancer, vaginal cancer, vulvar cancer, penile cancer, head and neck cancer, or oropharyngeal cancer. In some embodiments, the cancer is an HPV16-E7-positive squamous cell carcinoma.
In some embodiments, the individual is human.
[0489] In some embodiments, there is provided a method of treating an HPV16-E7 -positive disease in an individual comprising administering to the individual an effective amount of a composition comprising an anti-E7MC construct comprising an anti-E7MC antibody moiety that specifically binds to a complex comprising an HPV16-E7 peptide and an MHC class I protein, wherein the anti-E7MC antibody moiety comprises: i) a heavy chain variable domain sequence comprising an HC-CDRl comprising the amino acid sequence of SEQ ID NO: 183, or a variant thereof comprising up to about 3 (for example about any of 1, 2, or 3) amino acid substitutions, an HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 184 or 185, or a variant thereof comprising up to about 3 (for example about any of 1, 2, or 3) amino acid substitutions, and an HC-CDR3 comprising the amino acid sequence of any one of SEQ ID NOs: 186-188, or a variant thereof comprising up to about 3 (for example about any of 1, 2, or 3) amino acid substitutions; and ii) a light chain variable domain comprising an LC-CDR1 comprising the amino acid sequence of SEQ ID NO: 189 or 190, or a variant thereof comprising up to about 3 (for example about any of 1, 2, or 3) amino acid substitutions, and an LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 191, or a variant thereof comprising up to about 3 (for example about any of 1, 2, or 3) amino acid substitutions. In some embodiments, the anti-E7MC construct is non-naturally occurring. In some
embodiments, the anti-E7MC construct is a full-length antibody. In some embodiments, the anti-E7MC construct is a multi- specific (such as bispecific) molecule. In some embodiments, the anti-E7MC construct is a chimeric antigen receptor. In some embodiments, the anti- E7MC construct is an immunoconjugate. In some embodiments, the composition further comprises a cell (such as an effector cell) associated with the anti-E7MC construct. In some embodiments, the HPV16-E7-positive disease is cancer. In some embodiments, the cancer is, for example, squamous cell carcinoma, cervical cancer, anal cancer, vaginal cancer, vulvar cancer, penile cancer, head and neck cancer, or oropharyngeal cancer. In some embodiments, the cancer is an HPV16-E7-positive squamous cell carcinoma. In some embodiments, the individual is human.
[0490] In some embodiments, there is provided a method of treating an HPV16-E7 -positive disease in an individual comprising administering to the individual an effective amount of a composition comprising an anti-E7MC construct comprising an anti-E7MC antibody moiety that specifically binds to a complex comprising an HPV16-E7 peptide and an MHC class I protein, wherein the anti-E7MC antibody moiety comprises: i) a heavy chain variable domain sequence comprising an HC-CDRl comprising the amino acid sequence of SEQ ID NO: 183,
an HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 184 or 185, and an HC- CDR3 comprising the amino acid sequence of any one of SEQ ID NOs: 186-188; and ii) a light chain variable domain comprising an LC-CDRl comprising the amino acid sequence of SEQ ID NO: 189 or 190, and an LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 191. In some embodiments, the anti-E7MC construct is non-naturally occurring. In some embodiments, the anti-E7MC construct is a full-length antibody. In some embodiments, the anti-E7MC construct is a multi- specific (such as bispecific) molecule. In some embodiments, the anti-E7MC construct is a chimeric antigen receptor. In some embodiments, the anti- E7MC construct is an immunoconjugate. In some embodiments, the composition further comprises a cell (such as an effector cell) associated with the anti-E7MC construct. In some embodiments, the HPV16-E7-positive disease is cancer. In some embodiments, the cancer is, for example, squamous cell carcinoma, cervical cancer, anal cancer, vaginal cancer, vulvar cancer, penile cancer, head and neck cancer, or oropharyngeal cancer. In some embodiments, the cancer is an HPV16-E7-positive squamous cell carcinoma. In some embodiments, the individual is human.
[0491] In some embodiments, there is provided a method of treating an HPV16-E7 -positive disease in an individual comprising administering to the individual an effective amount of a composition comprising an anti-E7MC construct comprising an anti-E7MC antibody moiety that specifically binds to a complex comprising an HPV16-E7 peptide and an MHC class I protein, wherein the anti-E7MC antibody moiety comprises: i) a heavy chain variable domain sequence comprising an HC-CDR1 comprising the amino acid sequence of any one of SEQ
ID NOs: 57-77, or a variant thereof comprising up to about 5 (for example about any of 1, 2,
3, 4, or 5) amino acid substitutions; an HC-CDR2 comprising the amino acid sequence of any one of SEQ ID NOs: 78-98, or a variant thereof comprising up to about 5 (for example about any of 1, 2, 3, 4, or 5) amino acid substitutions; and an HC-CDR3 comprising the amino acid sequence of any one of SEQ ID NOs: 99-119, 244, and 245; or a variant thereof comprising up to about 5 (for example about any of 1, 2, 3, 4, or 5) amino acid substitutions; and ii) a light chain variable domain sequence comprising an LC-CDRl comprising the amino acid sequence of any one of SEQ ID NOs: 120-140 and 246, or a variant thereof comprising up to about 5 (for example about any of 1, 2, 3, 4, or 5) amino acid substitutions; an LC-CDR2 comprising the amino acid sequence of any one of SEQ ID NOs: 141-161, or a variant thereof comprising up to about 3 (for example about any of 1, 2, or 3) amino acid
substitutions; and an LC-CDR3 comprising the amino acid sequence of any one of SEQ ID
NOs: 162-182 and 247-250; or a variant thereof comprising up to about 5 (for example about any of 1, 2, 3, 4, or 5) amino acid substitutions. In some embodiments, the anti-E7MC construct is non-naturally occurring. In some embodiments, the anti-E7MC construct is a full- length antibody. In some embodiments, the anti-E7MC construct is a multi- specific (such as bispecific) molecule. In some embodiments, the anti-E7MC construct is a chimeric antigen receptor. In some embodiments, the anti-E7MC construct is an immunoconjugate. In some embodiments, the composition further comprises a cell (such as an effector cell) associated with the anti-E7MC construct. In some embodiments, the HPV16-E7-positive disease is cancer. In some embodiments, the cancer is, for example, squamous cell carcinoma, cervical cancer, anal cancer, vaginal cancer, vulvar cancer, penile cancer, head and neck cancer, or oropharyngeal cancer. In some embodiments, the cancer is an HPV16-E7-positive squamous cell carcinoma. In some embodiments, the individual is human.
[0492] In some embodiments, there is provided a method of treating an HPV16-E7 -positive disease in an individual comprising administering to the individual an effective amount of a composition comprising an anti-E7MC construct comprising an anti-E7MC antibody moiety that specifically binds to a complex comprising an HPV16-E7 peptide and an MHC class I protein, wherein the anti-E7MC antibody moiety comprises: i) a heavy chain variable domain sequence comprising an HC-CDR1 comprising the amino acid sequence of any one of SEQ
ID NOs: 57-77; an HC-CDR2 comprising the amino acid sequence of any one of SEQ ID
NOs: 78-98; and an HC-CDR3 comprising the amino acid sequence of any one of SEQ ID
NOs: 99-119, 244, and 245; or a variant thereof comprising up to about 5 (for example about any of 1, 2, 3, 4, or 5) amino acid substitutions in the HC-CDR sequences; and ii) a light chain variable domain sequence comprising an LC-CDR1 comprising the amino acid sequence of any one of SEQ ID NOs: 120-140 and 246; an LC-CDR2 comprising the amino acid sequence of any one of SEQ ID NOs: 141-161; and an LC-CDR3 comprising the amino acid sequence of any one of SEQ ID NOs: 162-182 and 247-250; or a variant thereof comprising up to about 5 (for example about any of 1, 2, 3, 4, or 5) amino acid substitutions in the LC-CDR sequences. In some embodiments, the anti-E7MC construct is non-naturally occurring. In some embodiments, the anti-E7MC construct is a full-length antibody. In some embodiments, the anti-E7MC construct is a multi- specific (such as bispecific) molecule. In some embodiments, the anti-E7MC construct is a chimeric antigen receptor. In some embodiments, the anti-E7MC construct is an immunoconjugate. In some embodiments, the composition further comprises a cell (such as an effector cell) associated with the anti-E7MC
construct. In some embodiments, the HPV16-E7-positive disease is cancer. In some embodiments, the cancer is, for example, squamous cell carcinoma, cervical cancer, anal cancer, vaginal cancer, vulvar cancer, penile cancer, head and neck cancer, or oropharyngeal cancer. In some embodiments, the cancer is an HPV16-E7-positive squamous cell carcinoma. In some embodiments, the individual is human.
[0493] In some embodiments, there is provided a method of treating an HPV16-E7 -positive disease in an individual comprising administering to the individual an effective amount of a composition comprising an anti-E7MC construct comprising an anti-E7MC antibody moiety that specifically binds to a complex comprising an HPV16-E7 peptide and an MHC class I protein, wherein the anti-E7MC antibody moiety comprises: i) a heavy chain variable domain sequence comprising an HC-CDR1 comprising the amino acid sequence of any one of SEQ ID NOs: 57-77; an HC-CDR2 comprising the amino acid sequence of any one of SEQ ID NOs: 78-98; and an HC-CDR3 comprising the amino acid sequence of any one of SEQ ID NOs: 99-119, 244, and 245; and ii) a light chain variable domain sequence comprising an LC-CDR1 comprising the amino acid sequence of any one of SEQ ID NOs: 120-140 and 246; an LC-CDR2 comprising the amino acid sequence of any one of SEQ ID NOs: 141-161; and an LC-CDR3 comprising the amino acid sequence of any one of SEQ ID NOs: 162-182 and 247-250. In some embodiments, the anti-E7MC construct is non-naturally occurring. In some embodiments, the anti-E7MC construct is a full-length antibody. In some embodiments, the anti-E7MC construct is a multi- specific (such as bispecific) molecule. In some
embodiments, the anti-E7MC construct is a chimeric antigen receptor. In some embodiments, the anti-E7MC construct is an immunoconjugate. In some embodiments, the composition further comprises a cell (such as an effector cell) associated with the anti-E7MC construct. In some embodiments, the HPV16-E7-positive disease is cancer. In some embodiments, the cancer is, for example, squamous cell carcinoma, cervical cancer, anal cancer, vaginal cancer, vulvar cancer, penile cancer, head and neck cancer, or oropharyngeal cancer. In some embodiments, the cancer is an HPV16-E7-positive squamous cell carcinoma. In some embodiments, the individual is human.
[0494] In some embodiments, there is provided a method of treating an HPV16-E7 -positive disease in an individual comprising administering to the individual an effective amount of a composition comprising an anti-E7MC construct comprising an anti-E7MC antibody moiety that specifically binds to a complex comprising an HPV16-E7 peptide and an MHC class I protein, wherein the anti-E7MC antibody moiety comprises a heavy chain variable domain
comprising the amino acid sequence of any one of SEQ ID NOs: 15-35 and 233-237, or a variant thereof having at least about 95% (for example at least about any of 96%, 97%, 98%, or 99%) sequence identity, and a light chain variable domain comprising the amino acid sequence of any one of SEQ ID NOs: 36-56 and 238-243, or a variant thereof having at least about 95% (for example at least about any of 96%, 97%, 98%, or 99%) sequence identity. In some embodiments, the anti-E7MC construct is non-naturally occurring. In some
embodiments, the anti-E7MC construct is a full-length antibody. In some embodiments, the anti-E7MC construct is a multi- specific (such as bispecific) molecule. In some embodiments, the anti-E7MC construct is a chimeric antigen receptor. In some embodiments, the anti- E7MC construct is an immunoconjugate. In some embodiments, the composition further comprises a cell (such as an effector cell) associated with the anti-E7MC construct. In some embodiments, the HPV16-E7-positive disease is cancer. In some embodiments, the cancer is, for example, squamous cell carcinoma, cervical cancer, anal cancer, vaginal cancer, vulvar cancer, penile cancer, head and neck cancer, or oropharyngeal cancer. In some embodiments, the cancer is an HPV16-E7-positive squamous cell carcinoma. In some embodiments, the individual is human.
[0495] In some embodiments, there is provided a method of treating an HPV16-E7 -positive disease in an individual comprising administering to the individual an effective amount of a composition comprising an anti-E7MC construct comprising an anti-E7MC antibody moiety that specifically binds to a complex comprising an HPV16-E7 peptide and an MHC class I protein, wherein the anti-E7MC antibody moiety comprises a heavy chain variable domain comprising the amino acid sequence of any one of SEQ ID NOs: 15-35 and 233-237 and a light chain variable domain comprising the amino acid sequence of any one of SEQ ID NOs: 36-56 and 238-243. In some embodiments, the anti-E7MC construct is non-naturally occurring. In some embodiments, the anti-E7MC construct is a full-length antibody. In some embodiments, the anti-E7MC construct is a multi- specific (such as bispecific) molecule. In some embodiments, the anti-E7MC construct is a chimeric antigen receptor. In some embodiments, the anti-E7MC construct is an immunoconjugate. In some embodiments, the composition further comprises a cell (such as an effector cell) associated with the anti-E7MC construct. In some embodiments, the HPV16-E7-positive disease is cancer. In some embodiments, the cancer is, for example, squamous cell carcinoma, cervical cancer, anal cancer, vaginal cancer, vulvar cancer, penile cancer, head and neck cancer, or oropharyngeal
cancer. In some embodiments, the cancer is an HPV16-E7-positive squamous cell carcinoma. In some embodiments, the individual is human.
[0496] In some embodiments of any of the methods for treating an HPV16-E7-positive disease described above, the anti-E7MC construct is conjugated to a cell (such as an immune cell, e.g. , a T cell) prior to being administered to the individual. Thus, for example, there is provided a method of treating an HPV16-E7-positive disease in an individual comprising a) conjugating any one of the anti-E7MC constructs described herein to a cell (such as an immune cell, e.g. , a T cell) to form an anti-E7MC construct/cell conjugate, and b)
administering to the individual an effective amount of a composition comprising the anti- E7MC construct/cell conjugate. In some embodiments, the cell is derived from the individual. In some embodiments, the cell is not derived from the individual. In some embodiments, the anti-E7MC construct is conjugated to the cell by covalent linkage to a molecule on the surface of the cell. In some embodiments, the anti-E7MC construct is conjugated to the cell by non-covalent linkage to a molecule on the surface of the cell. In some embodiments, the anti-E7MC construct is conjugated to the cell by insertion of a portion of the anti-E7MC construct into the outer membrane of the cell. In some embodiments, the anti-E7MC construct is non-naturally occurring. In some embodiments, the anti-E7MC construct is a full- length antibody. In some embodiments, the anti-E7MC construct is a multi- specific (such as bispecific) molecule. In some embodiments, the anti-E7MC construct is a chimeric antigen receptor. In some embodiments, the anti-E7MC construct is an immunoconjugate. In some embodiments, the HPV16-E7-positive disease is cancer. In some embodiments, the cancer is, for example, squamous cell carcinoma, cervical cancer, anal cancer, vaginal cancer, vulvar cancer, penile cancer, head and neck cancer, or oropharyngeal cancer. In some embodiments, the cancer is an HPV16-E7-positive squamous cell carcinoma. In some embodiments, the individual is human.
[0497] In some embodiments, the individual is a mammal (e.g. , human, non-human primate, rat, mouse, cow, horse, pig, sheep, goat, dog, cat, etc.). In some embodiments, the individual is a human. In some embodiments, the individual is a clinical patient, a clinical trial volunteer, an experimental animal, etc. In some embodiments, the individual is younger than about 60 years old (including for example younger than about any of 50, 40, 30, 25, 20,
15, or 10 years old). In some embodiments, the individual is older than about 60 years old
(including for example older than about any of 70, 80, 90, or 100 years old). In some embodiments, the individual is diagnosed with or genetically prone to one or more of the
diseases or disorders described herein (such as squamous cell carcinoma, cervical cancer, anal cancer, vaginal cancer, vulvar cancer, penile cancer, head and neck cancer, or oropharyngeal cancer). In some embodiments, the individual has one or more risk factors associated with one or more diseases or disorders described herein.
[0498] The present application in some embodiments provides a method of delivering an anti-E7MC construct (such as any one of the anti-E7MC constructs described herein) to a cell presenting on its surface a complex comprising an HPV16-E7 peptide and an MHC class I protein in an individual, the method comprising administering to the individual a composition comprising the anti-E7MC construct. In some embodiments, the anti-E7MC construct to be delivered is associated with a cell (such as an effector cell, e.g. , a T cell).
[0499] Many diagnostic methods for HPV16-E7-positive cancer (such as squamous cell carcinoma, cervical cancer, anal cancer, vaginal cancer, vulvar cancer, penile cancer, head and neck cancer, or oropharyngeal cancer) or any other disease exhibiting HPV16-E7 expression and the clinical delineation of those diseases are known in the art. Such methods include, but are not limited to, e.g. , immunohistochemistry, PCR, and fluorescent in situ hybridization (FISH).
[0500] In some embodiments, the anti-E7MC constructs and/or compositions of the invention are administered in combination with a second, third, or fourth agent (including, e.g., an antineoplastic agent, a growth inhibitory agent, a cytotoxic agent, or a
chemotherapeutic agent) to treat diseases or disorders involving HPV16-E7 expression. In some embodiments, the anti-E7MC construct is administered in combination with an agent that increases the expression of MHC class I proteins and/or enhances the surface
presentation of HPV16-E7 peptides by MHC class I proteins. In some embodiments, the agent includes, for example, IFN receptor agonists, Hsp90 inhibitors, enhancers of p53 expression, and chemotherapeutic agents. In some embodiments, the agent is an IFN receptor agonist including, for example, IFNy, IFNP, and IFNa. In some embodiments, the agent is an Hsp90 inhibitor including, for example, tanespimycin (17-AAG), alvespimycin (17-DMAG), retaspimycin (IPI-504), IPI-493, CNF2024/BIIB021, MPC-3100, Debio 0932 (CUDC-305), PU-H71, Ganetespib (STA-9090), NVP-AUY922 (VER-52269), HSP990, KW-2478, AT13387, SNX-5422, DS-2248, and XL888. In some embodiments, the agent is an enhancer of p53 expression including, for example, 5-fluorouracil and nutlin-3. In some embodiments, the agent is a chemotherapeutic agent including, for example, topotecan, etoposide, cisplatin, paclitaxel, and vinblastine.
[0501] In some embodiments, there is provided a method of treating an HPV16-E7 -positive disease in an individual, wherein the cells expressing HPV16-E7 do not normally present, or present at relatively low levels, a complex comprising an HPV16-E7 protein and an MHC class I protein on their surface, the method comprising administering to the individual a composition comprising an anti-E7MC construct in combination with an agent that increases the expression of MHC class I proteins and/or enhances the surface presentation of HPV16- E7 peptides by MHC class I proteins. In some embodiments, the agent includes, for example, IFN receptor agonists, Hsp90 inhibitors, enhancers of p53 expression, and chemotherapeutic agents. In some embodiments, the agent is an IFN receptor agonist including, for example, IFNy, IFNP, and IFNa. In some embodiments, the agent is an Hsp90 inhibitor including, for example, tanespimycin (17-AAG), alvespimycin (17-DMAG), retaspimycin (IPI-504), IPI- 493, CNF2024/BIIB021, MPC-3100, Debio 0932 (CUDC-305), PU-H71, Ganetespib (STA- 9090), NVP-AUY922 (VER-52269), HSP990, KW-2478, AT13387, SNX-5422, DS-2248, and XL888. In some embodiments, the agent is an enhancer of p53 expression including, for example, 5-fluorouracil and nutlin-3. In some embodiments, the agent is a chemotherapeutic agent including, for example, topotecan, etoposide, cisplatin, paclitaxel, and vinblastine.
[0502] Cancer treatments can be evaluated, for example, by tumor regression, tumor weight or size shrinkage, time to progression, duration of survival, progression free survival, overall response rate, duration of response, quality of life, protein expression and/or activity.
Approaches to determining efficacy of the therapy can be employed, including for example, measurement of response through radiological imaging.
[0503] In some embodiments, the efficacy of treatment is measured as the percentage tumor growth inhibition (% TGI), calculated using the equation 100-(T/C x 100), where T is the mean relative tumor volume of the treated tumor, and C is the mean relative tumor volume of a non-treated tumor. In some embodiments, the %TGI is about 10%, about 20%, about 30%, about 40%, about 50%, about 60%, about 70%, about 80%, about 90%, about 91%, about 92%, about 93%, about 94% , about 95%, or more than 95%.
Dosing and Method of Administering the anti-E7MC construct Compositions
[0504] The dose of the anti-E7MC construct compositions administered to an individual (such as a human) may vary with the particular composition, the mode of administration, and the type of disease being treated. In some embodiments, the amount of the composition is effective to result in an objective response (such as a partial response or a complete
response). In some embodiments, the amount of the anti-E7MC construct composition is sufficient to result in a complete response in the individual. In some embodiments, the amount of the anti-E7MC construct composition is sufficient to result in a partial response in the individual. In some embodiments, the amount of the anti-E7MC construct composition administered (for example when administered alone) is sufficient to produce an overall response rate of more than about any of 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 64%, 65%, 70%, 75%, 80%, 85%, or 90% among a population of individuals treated with the anti-E7MC construct composition. Responses of an individual to the treatment of the methods described herein can be determined, for example, based on RECIST levels.
[0505] In some embodiments, the amount of the composition is sufficient to prolong progress-free survival of the individual. In some embodiments, the amount of the
composition is sufficient to prolong overall survival of the individual. In some embodiments, the amount of the composition (for example when administered along) is sufficient to produce clinical benefit of more than about any of 50%, 60%, 70%, or 77% among a population of individuals treated with the anti-E7MC construct composition.
[0506] In some embodiments, the amount of the composition, alone or in combination with a second, third, and/or fourth agent, is an amount sufficient to decrease the size of a tumor, decrease the number of cancer cells, or decrease the growth rate of a tumor by at least about any of 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90%, 95% or 100% compared to the corresponding tumor size, number of cancer cells, or tumor growth rate in the same subject prior to treatment or compared to the corresponding activity in other subjects not receiving the treatment. Standard methods can be used to measure the magnitude of this effect, such as in vitro assays with purified enzyme, cell-based assays, animal models, or human testing.
[0507] In some embodiments, the amount of the anti-E7MC construct (e.g., full-length anti-E7MC antibody, multi- specific anti-E7MC molecule, anti-E7MC CAR, or anti-E7MC immunoconjugate) in the composition is below the level that induces a toxicological effect (i.e., an effect above a clinically acceptable level of toxicity) or is at a level where a potential side effect can be controlled or tolerated when the composition is administered to the individual.
[0508] In some embodiments, the amount of the composition is close to a maximum tolerated dose (MTD) of the composition following the same dosing regimen. In some embodiments, the amount of the composition is more than about any of 80%, 90%, 95%, or 98% of the MTD.
[0509] In some embodiments, the amount of an anti-E7MC construct (e.g. , full-length anti- E7MC antibody, multi- specific anti-E7MC molecule, anti-E7MC CAR, or anti-E7MC immunoconjugate) in the composition is included in a range of about 0.001 μg to about 1000
[0510] In some embodiments of any of the above aspects, the effective amount of an anti- E7MC construct (e.g. , full-length anti-E7MC antibody, multi- specific anti-E7MC molecule, anti-E7MC CAR, or anti-E7MC immunoconjugate) in the composition is in the range of about 0.1 g/kg to about 100 mg/kg of total body weight.
[0511] The anti-E7MC construct compositions can be administered to an individual (such as human) via various routes, including, for example, intravenous, intra-arterial,
intraperitoneal, intrapulmonary, oral, inhalation, intravesicular, intramuscular, intra-tracheal, subcutaneous, intraocular, intrathecal, transmucosal, and transdermal. In some embodiments, sustained continuous release formulation of the composition may be used. In some embodiments, the composition is administered intravenously. In some embodiments, the composition is administered intraportally. In some embodiments, the composition is administered intraarterially. In some embodiments, the composition is administered intraperitoneally. In some embodiments, the composition is administered intrahepatically. In some embodiments, the composition is administered by hepatic arterial infusion.
Anti-E7MC CAR Effector Cell Therapy
[0512] The present application also provides methods of using an anti-E7MC CAR to redirect the specificity of an effector cell (such as a primary T cell) to a complex comprising an HPV16-E7 peptide and an MHC class I protein. Thus, the present invention also provides a method of stimulating an effector cell-mediated response (such as a T cell-mediated immune response) to a target cell population or tissue comprising E7MC-presenting cells in a mammal, comprising the step of administering to the mammal an effector cell (such as a T cell) that expresses an anti-E7MC CAR.
[0513] Anti-E7MC CAR effector cells (such as T cells) expressing the anti-E7MC CAR can be infused to a recipient in need thereof. The infused cell is able to kill E7MC-presenting cells in the recipient. In some embodiments, unlike antibody therapies, anti-E7MC CAR effector cells (such as T cells) are able to replicate in vivo resulting in long-term persistence that can lead to sustained tumor control.
[0514] In some embodiments, the anti-E7MC CAR effector cells are anti-E7MC CAR T cells that can undergo robust in vivo T cell expansion and can persist for an extended amount of time. In some embodiments, the anti-E7MC CAR T cells of the invention develop into specific memory T cells that can be reactivated to inhibit any additional tumor formation or growth.
[0515] The anti-E7MC CAR T cells of the invention may also serve as a type of vaccine for ex vivo immunization and/or in vivo therapy in a mammal. In some embodiments, the mammal is a human.
[0516] With respect to ex vivo immunization, of least one of the following occurs in vitro prior to administering the cell into a mammal: i) expansion of the cells, ii) introducing a nucleic acid encoding an anti-E7MC CAR to the cells, and/or iii) cryopreservation of the cells.
[0517] Ex vivo procedures are well known in the art and are discussed more fully below. Briefly, cells are isolated from a mammal (preferably a human) and genetically modified (i.e., transduced or transfected in vitro) with a vector expressing an anti-E7MC CAR disclosed herein. The anti-E7MC CAR cell can be administered to a mammalian recipient to provide a therapeutic benefit. The mammalian recipient may be a human and the anti-E7MC CAR cell can be autologous with respect to the recipient. Alternatively, the cells can be allogeneic, syngeneic or xenogeneic with respect to the recipient.
[0518] The procedure for ex vivo expansion of hematopoietic stem and progenitor cells is described in U.S. Pat. No. 5,199,942, incorporated herein by reference, can be applied to the cells of the present invention. Other suitable methods are known in the art, therefore the present invention is not limited to any particular method of ex vivo expansion of the cells. Briefly, ex vivo culture and expansion of T cells comprises: (1) collecting CD34+
hematopoietic stem and progenitor cells from a mammal from peripheral blood harvest or bone marrow explants; and (2) expanding such cells ex vivo. In addition to the cellular growth factors described in U.S. Pat. No. 5,199,942, other factors such as flt3-L, IL-1, IL-3 and c-kit ligand, can be used for culturing and expansion of the cells.
[0519] In addition to using a cell-based vaccine in terms of ex vivo immunization, the present invention also provides compositions and methods for in vivo immunization to elicit an immune response directed against an antigen in a patient.
[0520] The anti-E7MC CAR effector cells (such as T cells) of the present invention may be administered either alone, or as a pharmaceutical composition in combination with diluents
and/or with other components such as IL-2 or other cytokines or cell populations. Briefly, pharmaceutical compositions of the present invention may comprise anti-E7MC CAR effector cells (such as T cells), in combination with one or more pharmaceutically or physiologically acceptable carriers, diluents or excipients. Such compositions may comprise buffers such as neutral buffered saline, phosphate buffered saline and the like; carbohydrates such as glucose, mannose, sucrose or dextrans, mannitol; proteins; polypeptides or amino acids such as glycine; antioxidants; chelating agents such as EDTA or glutathione; adjuvants (e.g. , aluminum hydroxide); and preservatives. In some embodiments, anti-E7MC CAR effector cell (such as T cell) compositions are formulated for intravenous administration.
[0521] The precise amount of the anti-E7MC CAR effector cell (such as T cell) compositions of the present invention to be administered can be determined by a physician with consideration of individual differences in age, weight, tumor size, extent of infection or metastasis, and condition of the patient (subject). In some embodiments, a pharmaceutical composition comprising the anti-E7MC CAR effector cells (such as T cells) is administered at a dosage of about 104 to about 109 cells/kg body weight, such any of about 104 to about 105, about 105 to about 106, about 106 to about 107, about 107 to about 108, or about 108 to about 109 cells/kg body weight, including all integer values within those ranges. Anti-E7MC CAR effect cell (such as T cell) compositions may also be administered multiple times at these dosages. The cells can be administered by using infusion techniques that are commonly known in immunotherapy (see, e.g. , Rosenberg et ah , New Eng. J. of Med. 319: 1676, 1988). The optimal dosage and treatment regimen for a particular patient can readily be determined by one skilled in the art of medicine by monitoring the patient for signs of disease and adjusting the treatment accordingly.
[0522] In some embodiments, it may be desired to administer activated anti-E7MC CAR T cells to a subject and then subsequently redraw blood (or have an apheresis performed), activate T cells therefrom according to the present invention, and reinfuse the patient with these activated and expanded T cells. This process can be carried out multiple times every few weeks. In some embodiments, T cells can be activated from blood draws of from 10 cc to 400 cc. In some embodiments, T cells are activated from blood draws of 20 cc, 30 cc, 40 cc, 50 cc, 60 cc, 70 cc, 80 cc, 90 cc, or 100 cc.
[0523] The administration of the anti-E7MC CAR effector cells (such as T cells) may be carried out in any convenient manner, including by aerosol inhalation, injection, ingestion, transfusion, implantation or transplantation. The compositions described herein may be
administered to a patient subcutaneously, intradermally, intratumorally, intranodally, intramedullary, intramuscularly, by intravenous (i.v.) injection, or intraperitoneally. In some embodiments, the anti-E7MC CAR effector cell (such as T cell) compositions of the present invention are administered to a patient by intradermal or subcutaneous injection. In some embodiments, the anti-E7MC CAR effector cell (such as T cell) compositions of the present invention are administered by i.v. injection. The compositions of anti-E7MC CAR effector cells (such as T cells) may be injected directly into a tumor, lymph node, or site of infection.
[0524] Thus, for example, in some embodiments, there is provided a method of treating an
HPV16-E7-positive disease in an individual comprising administering to the individual an effective amount of a composition comprising an effector cell (such as a T cell) expressing an anti-E7MC CAR comprising a) an extracellular domain comprising an anti-E7MC antibody moiety that specifically binds to a complex comprising an HPV16-E7 peptide and an MHC class I protein, b) a transmembrane domain, and c) an intracellular signaling domain comprising a CD3ζ intracellular signaling sequence and a CD28 intracellular signaling sequence. In some embodiments, the HPV16-E7 peptide is HPV16-E7 11-19 (SEQ ID NO:
4). In some embodiments, the MHC class I protein is HLA-A02. In some embodiments, the
MHC class I protein is HLA-A*02:01. In some embodiments, the HPV16-E7-positive disease is cancer. In some embodiments, the cancer is, for example, squamous cell carcinoma, cervical cancer, anal cancer, vaginal cancer, vulvar cancer, penile cancer, head and neck cancer, or oropharyngeal cancer. In some embodiments, the cancer is an HPV16-E7-positive squamous cell carcinoma. In some embodiments, the individual is human.
[0525] In some embodiments, there is provided a method of treating an HPV16-E7 -positive disease in an individual comprising administering to the individual an effective amount of a composition comprising an effector cell (such as a T cell) expressing an anti-E7MC CAR comprising a) an extracellular domain comprising an anti-E7MC antibody moiety that specifically binds to a complex comprising an HPV16-E7 11-19 peptide (SEQ ID NO: 4) and
HLA-A*02:01, b) a transmembrane domain, and c) an intracellular signaling domain comprising a CD3ζ intracellular signaling sequence and a CD28 intracellular signaling sequence. In some embodiments, the HPV16-E7-positive disease is cancer. In some embodiments, the cancer is, for example, squamous cell carcinoma, cervical cancer, anal cancer, vaginal cancer, vulvar cancer, penile cancer, head and neck cancer, or oropharyngeal cancer. In some embodiments, the cancer is an HPV16-E7-positive squamous cell carcinoma.
In some embodiments, the individual is human.
[0526] In some embodiments, there is provided a method of treating an HPV16-E7 -positive disease in an individual comprising administering to the individual an effective amount of a composition comprising an effector cell (such as a T cell) expressing an anti-E7MC CAR comprising a) an extracellular domain comprising an anti-E7MC antibody moiety that specifically binds to a complex comprising an HPV16-E7 peptide and an MHC class I protein comprising i) a heavy chain variable domain sequence comprising an HC-CDR1 comprising the amino acid sequence of SEQ ID NO: 183, or a variant thereof comprising up to about 3
(for example about any of 1, 2, or 3) amino acid substitutions, an HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 184 or 185, or a variant thereof comprising up to about
3 (for example about any of 1, 2, or 3) amino acid substitutions, and an HC-CDR3 comprising the amino acid sequence of any one of SEQ ID NOs: 186-188, or a variant thereof comprising up to about 3 (for example about any of 1, 2, or 3) amino acid
substitutions; and ii) a light chain variable domain comprising an LC-CDR1 comprising the amino acid sequence of SEQ ID NO: 189 or 190, or a variant thereof comprising up to about
3 (for example about any of 1, 2, or 3) amino acid substitutions, and an LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 191, or a variant thereof comprising up to about 3
(for example about any of 1, 2, or 3) amino acid substitutions, b) a transmembrane domain, and c) an intracellular signaling domain comprising a CD3ζ intracellular signaling sequence and a CD28 intracellular signaling sequence. In some embodiments, the HPV16-E7 -positive disease is cancer. In some embodiments, the cancer is, for example, squamous cell carcinoma, cervical cancer, anal cancer, vaginal cancer, vulvar cancer, penile cancer, head and neck cancer, or oropharyngeal cancer. In some embodiments, the cancer is an HPV16-
E7-positive squamous cell carcinoma. In some embodiments, the individual is human.
[0527] In some embodiments, there is provided a method of treating an HPV16-E7 -positive disease in an individual comprising administering to the individual an effective amount of a composition comprising an effector cell (such as a T cell) expressing an anti-E7MC CAR comprising a) an extracellular domain comprising an anti-E7MC antibody moiety that specifically binds to a complex comprising an HPV16-E7 peptide and an MHC class I protein comprising i) a heavy chain variable domain sequence comprising an HC-CDR1 comprising the amino acid sequence of SEQ ID NO: 183, an HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 184 or 185, and an HC-CDR3 comprising the amino acid sequence of any one of SEQ ID NOs: 186-188; and ii) a light chain variable domain comprising an LC-
CDR1 comprising the amino acid sequence of SEQ ID NO: 189 or 190, and an LC-CDR3
comprising the amino acid sequence of SEQ ID NO: 191, b) a transmembrane domain, and c) an intracellular signaling domain comprising a CD3ζ intracellular signaling sequence and a
CD28 intracellular signaling sequence. In some embodiments, the HPV16-E7-positive disease is cancer. In some embodiments, the cancer is, for example, squamous cell carcinoma, cervical cancer, anal cancer, vaginal cancer, vulvar cancer, penile cancer, head and neck cancer, or oropharyngeal cancer. In some embodiments, the cancer is an HPV16-
E7-positive squamous cell carcinoma. In some embodiments, the individual is human.
[0528] In some embodiments, there is provided a method of treating an HPV16-E7 -positive disease in an individual comprising administering to the individual an effective amount of a composition comprising an effector cell (such as a T cell) expressing an anti-E7MC CAR comprising a) an extracellular domain comprising an anti-E7MC antibody moiety that specifically binds to a complex comprising an HPV16-E7 peptide and an MHC class I protein comprising i) a heavy chain variable domain comprising an HC-CDR1 comprising the amino acid sequence of any one of SEQ ID NOs: 57-77, or a variant thereof comprising up to about
5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions, an HC-CDR2 comprising the amino acid sequence of any one of SEQ ID NOs: 78-98, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions, and an HC-CDR3 comprising the amino acid sequence of any one of SEQ ID NOs: 99-119, 244, and 245, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions; and ii) a light chain variable domain comprising an LC-CDR1 comprising the amino acid sequence of any one of SEQ ID NOs: 120-140 and 246, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions, an
LC-CDR2 comprising the amino acid sequence of any one of SEQ ID NOs: 141-161, or a variant thereof comprising up to about 3 (such as about any of 1, 2, or 3) amino acid substitutions, and an LC-CDR3 comprising the amino acid sequence of any one of SEQ ID
NOs: 162-182 and 247-250, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions; b) a transmembrane domain, and c) an
intracellular signaling domain comprising a CD3ζ intracellular signaling sequence and a
CD28 intracellular signaling sequence. In some embodiments, the HPV16-E7-positive disease is cancer. In some embodiments, the cancer is, for example, squamous cell carcinoma, cervical cancer, anal cancer, vaginal cancer, vulvar cancer, penile cancer, head and neck cancer, or oropharyngeal cancer. In some embodiments, the cancer is an HPV16-
E7-positive squamous cell carcinoma. In some embodiments, the individual is human.
[0529] In some embodiments, there is provided a method of treating an HPV16-E7 -positive disease in an individual comprising administering to the individual an effective amount of a composition comprising an effector cell (such as a T cell) expressing an anti-E7MC CAR comprising a) an extracellular domain comprising an anti-E7MC antibody moiety that specifically binds to a complex comprising an HPV16-E7 peptide and an MHC class I protein comprising i) a heavy chain variable domain sequence comprising an HC-CDR1 comprising the amino acid sequence of any one of SEQ ID NOs: 57-77; an HC-CDR2 comprising the amino acid sequence of any one of SEQ ID NOs: 78-98; and an HC-CDR3 comprising the amino acid sequence of any one of SEQ ID NOs: 99-119, 244, and 245; or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions in the
HC-CDR sequences; and ii) a light chain variable domain sequence comprising an LC-CDR1 comprising the amino acid sequence of any one of SEQ ID NOs: 120-140 and 246; an LC-
CDR2 comprising the amino acid sequence of any one of SEQ ID NOs: 141-161; and an LC-
CDR3 comprising the amino acid sequence of any one of SEQ ID NOs: 162-182 and 247-
250; or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions in the LC-CDR sequences; b) a transmembrane domain, and c) an intracellular signaling domain comprising a CD3ζ intracellular signaling sequence and a
CD28 intracellular signaling sequence. In some embodiments, the HPV16-E7-positive disease is cancer. In some embodiments, the cancer is, for example, squamous cell carcinoma, cervical cancer, anal cancer, vaginal cancer, vulvar cancer, penile cancer, head and neck cancer, or oropharyngeal cancer. In some embodiments, the cancer is an HPV16-
E7-positive squamous cell carcinoma. In some embodiments, the individual is human.
[0530] In some embodiments, there is provided a method of treating an HPV16-E7 -positive disease in an individual comprising administering to the individual an effective amount of a composition comprising an effector cell (such as a T cell) expressing an anti-E7MC CAR comprising a) an extracellular domain comprising an anti-E7MC antibody moiety that specifically binds to a complex comprising an HPV16-E7 peptide and an MHC class I protein comprising i) a heavy chain variable domain sequence comprising an HC-CDR 1 comprising the amino acid sequence of any one of SEQ ID NOs: 57-77; an HC-CDR2 comprising the amino acid sequence of any one of SEQ ID NOs: 78-98; and an HC-CDR3 comprising the amino acid sequence of any one of SEQ ID NOs: 99-119, 244, and 245; and ii) a light chain variable domain sequence comprising an LC-CDR 1 comprising the amino acid sequence of any one of SEQ ID NOs: 120-140 and 246; an LC-CDR2 comprising the amino acid
sequence of any one of SEQ ID NOs: 141-161; and an LC-CDR3 comprising the amino acid sequence of any one of SEQ ID NOs: 162-182 and 247-250; b) a transmembrane domain, and c) an intracellular signaling domain comprising a CD3ζ intracellular signaling sequence and a
CD28 intracellular signaling sequence. In some embodiments, the HPV16-E7-positive disease is cancer. In some embodiments, the cancer is, for example, squamous cell carcinoma, cervical cancer, anal cancer, vaginal cancer, vulvar cancer, penile cancer, head and neck cancer, or oropharyngeal cancer. In some embodiments, the cancer is an HPV16-
E7-positive squamous cell carcinoma. In some embodiments, the individual is human.
[0531] In some embodiments, there is provided a method of treating an HPV16-E7 -positive disease in an individual comprising administering to the individual an effective amount of a composition comprising an effector cell (such as a T cell) expressing an anti-E7MC CAR comprising a) an extracellular domain comprising an anti-E7MC antibody moiety that specifically binds to a complex comprising an HPV16-E7 peptide and an MHC class I protein comprising i) a heavy chain variable domain comprising the amino acid sequence of any one of SEQ ID NOs: 15-35 and 233-237, or a variant thereof having at least about 95% (for example at least about any of 96%, 97%, 98%, or 99%) sequence identity, and a light chain variable domain comprising the amino acid sequence of any one of SEQ ID NOs: 36-56 and
238-243, or a variant thereof having at least about 95% (including for example at least about any of 96%, 97%, 98%, or 99%) sequence identity; b) a transmembrane domain, and c) an intracellular signaling domain comprising a CD3ζ intracellular signaling sequence and a
CD28 intracellular signaling sequence. In some embodiments, the HPV16-E7-positive disease is cancer. In some embodiments, the cancer is, for example, squamous cell carcinoma, cervical cancer, anal cancer, vaginal cancer, vulvar cancer, penile cancer, head and neck cancer, or oropharyngeal cancer. In some embodiments, the cancer is an HPV16-
E7-positive squamous cell carcinoma. In some embodiments, the individual is human.
[0532] In some embodiments, there is provided a method of treating an HPV16-E7 -positive disease in an individual comprising administering to the individual an effective amount of a composition comprising an effector cell (such as a T cell) expressing an anti-E7MC CAR comprising a) an extracellular domain comprising an anti-E7MC antibody moiety that specifically binds to a complex comprising an HPV16-E7 peptide and an MHC class I protein comprising a heavy chain variable domain comprising the amino acid sequence of any one of
SEQ ID NOs: 15-35 and 233-237 and a light chain variable domain comprising the amino acid sequence of any one of SEQ ID NOs: 36-56 and 238-243; b) a transmembrane domain,
and c) an intracellular signaling domain comprising a CD3ζ intracellular signaling sequence and a CD28 intracellular signaling sequence. In some embodiments, the HPV16-E7 -positive disease is cancer. In some embodiments, the cancer is, for example, squamous cell carcinoma, cervical cancer, anal cancer, vaginal cancer, vulvar cancer, penile cancer, head and neck cancer, or oropharyngeal cancer. In some embodiments, the cancer is an HPV16- E7-positive squamous cell carcinoma. In some embodiments, the individual is human.
Cancers
[0533] The anti-E7MC constructs and anti-E7MC CAR cells in some embodiments can be useful for treating HPV16-E7-positive cancer. Cancers that may be treated using any of the methods described herein include tumors that are not vascularized, or not yet substantially vascularized, as well as vascularized tumors. The cancers may comprise non-solid tumors (such as hematological tumors, for example, leukemias and lymphomas) or may comprise solid tumors. Types of cancers to be treated with the anti-E7MC constructs and anti-E7MC CAR cells of the invention include, but are not limited to, carcinoma, blastoma, and sarcoma, and certain leukemia or lymphoid malignancies, benign and malignant tumors, and malignancies e.g. , sarcomas, carcinomas, and melanomas. Adult tumors/cancers and pediatric tumors/cancers are also included.
[0534] Hematologic cancers are cancers of the blood or bone marrow. Examples of hematological (or hematogenous) cancers include leukemias, including acute leukemias (such as acute lymphocytic leukemia, acute myelocytic leukemia, acute myelogenous leukemia and myeloblasts, promyelocytic, myelomonocytic, monocytic and erythroleukemia), chronic leukemias (such as chronic myelocytic (granulocytic) leukemia, chronic myelogenous leukemia, and chronic lymphocytic leukemia), polycythemia vera, lymphoma, Hodgkin's disease, non-Hodgkin's lymphoma (indolent and high grade forms), multiple myeloma, Waldenstrom's macroglobulinemia, heavy chain disease, myelodysplastic syndrome, hairy cell leukemia and myelodysplasia.
[0535] Solid tumors are abnormal masses of tissue that usually do not contain cysts or liquid areas. Solid tumors can be benign or malignant. Different types of solid tumors are named for the type of cells that form them (such as sarcomas, carcinomas, and lymphomas). Examples of solid tumors, such as sarcomas and carcinomas, include fibrosarcoma, myxosarcoma, liposarcoma, chondrosarcoma, osteosarcoma, and other sarcomas, synovioma, mesothelioma, Ewing's tumor, leiomyosarcoma, rhabdomyosarcoma, colon carcinoma,
lymphoid malignancy, pancreatic cancer, breast cancer, lung cancers, ovarian cancer, prostate cancer, hepatocellular carcinoma, squamous cell carcinoma, basal cell carcinoma,
adenocarcinoma, sweat gland carcinoma, medullary thyroid carcinoma, papillary thyroid carcinoma, pheochromocytomas sebaceous gland carcinoma, papillary carcinoma, papillary adenocarcinomas, medullary carcinoma, bronchogenic carcinoma, renal cell carcinoma, hepatoma, bile duct carcinoma, choriocarcinoma, Wilms' tumor, cervical cancer (e.g., cervical carcinoma and pre-invasive cervical dysplasia), cancer of the anus, anal canal, or anorectum, vaginal cancer, cancer of the vulva (e.g., squamous cell carcinoma, intraepithelial carcinoma, adenocarcinoma, and fibrosarcoma), penile cancer, oropharyngeal cancer, head cancers (e.g., squamous cell carcinoma), neck cancers (e.g., squamous cell carcinoma), testicular cancer (e.g., seminoma, teratoma, embryonal carcinoma, teratocarcinoma, choriocarcinoma, sarcoma, Leydig cell tumor, fibroma, fibroadenoma, adenomatoid tumors, and lipoma), bladder carcinoma, melanoma, cancer of the uterus (e.g., endometrial carcinoma), urothelial cancers (e.g., squamous cell carcinoma, transitional cell carcinoma, adenocarcinoma, ureter cancer, and urinary bladder cancer), and CNS tumors (such as a glioma (such as brainstem glioma and mixed gliomas), glioblastoma (also known as glioblastoma multiforme) astrocytoma, CNS lymphoma, germinoma, medulloblastoma, Schwannoma craniopharyogioma, ependymoma, pinealoma, hemangioblastoma, acoustic neuroma, oligodendroglioma, menangioma, neuroblastoma, retinoblastoma and brain metastases).
[0536] Cancer treatments can be evaluated, for example, by tumor regression, tumor weight or size shrinkage, time to progression, duration of survival, progression free survival, overall response rate, duration of response, quality of life, protein expression and/or activity.
Approaches to determining efficacy of the therapy can be employed, including for example, measurement of response through radiological imaging.
Methods for Diagnosis and Imaging Using anti-E7MC constructs
[0537] Labeled anti-E7MC antibody moieties and derivatives and analogs thereof, which specifically bind to an E7MC on the surface of a cell, can be used for diagnostic purposes to detect, diagnose, or monitor diseases and/or disorders associated with the expression of HPV16-E7, including any of the diseases and disorders described above, such as cancer. For example, the anti-E7MC antibody moieties of the invention can be used in in situ, in vivo, ex vivo, and in vitro diagnostic assays or imaging assays.
[0538] Additional embodiments of the invention include methods of diagnosing a disease or disorder associated with expression of HPV16-E7 in an individual (e.g., a mammal such as a human). The methods comprise detecting E7MC-presenting cells in the individual. In some embodiments, there is provided a method of diagnosing a disease or disorder associated with expression of HPV16-E7 in an individual (e.g., a mammal, such as a human) comprising (a) administering an effective amount of a labeled anti-E7MC antibody moiety according to any of the embodiments described above to the individual; and (b) determining the level of the label in the individual, such that a level of the label above a threshold level indicates that the individual has the disease or disorder. The threshold level can be determined by various methods, including, for example, by detecting the label according to the method of diagnosing described above in a first set of individuals that have the disease or disorder and a second set of individuals that do not have the disease or disorder, and setting the threshold to a level that allows for discrimination between the first and second sets. In some
embodiments, the threshold level is zero, and the method comprises determining the presence or absence of the label in the individual. In some embodiments, the method further comprises waiting for a time interval following the administering of step (a) to permit the labeled anti-
E7MC antibody moiety to preferentially concentrate at sites in the individual where the
E7MC is expressed (and for unbound labeled anti-E7MC antibody moiety to be cleared). In some embodiments, the method further comprises subtracting a background level of the label.
Background level can be determined by various methods, including, for example, by detecting the label in the individual prior to administration of the labeled anti-E7MC antibody moiety, or by detecting the label according to the method of diagnosing described above in an individual that does not have the disease or disorder. In some embodiments, the disease or disorder is cancer. In some embodiments, the cancer is selected, for example, from the group consisting of squamous cell carcinoma, cervical cancer, anal cancer, vaginal cancer, vulvar cancer, penile cancer, head and neck cancer, or oropharyngeal cancer.
[0539] Anti-E7MC antibody moieties of the invention can be used to assay levels of E7MC-presenting cell in a biological sample using methods known to those of skill in the art. Suitable antibody labels are known in the art and include enzyme labels, such as, glucose oxidase; radioisotopes, such as iodine ( 131 I, 125 I, 123 I, 121 I), carbon ( 14 C), sulfur ( 35 S), tritium (3H), indium (115mIn, 113mIn, 112In, mIn), technetium (99Tc, 99mTc), thallium (201Ti), gallium (68Ga, 67Ga), palladium (103Pd), molybdenum (99Mo), xenon (133Xe), fluorine (18F), samarium (153Sm), lutetium (177Lu), gadolinium (159Gd), promethium (149Pm), lanthanum (140La), ytterbium (175Yb) , holmium (166Ho), yttrium (90Y), scandium (47Sc), rhenium (186Re, 188Re), praseodymium (142Pr), rhodium (105Rh), and ruthenium (97Ru); luminol; fluorescent labels, such as fluorescein and rhodamine; and biotin.
[0540] Techniques known in the art may be applied to labeled anti-E7MC antibody moieties of the invention. Such techniques include, but are not limited to, the use of bifunctional conjugating agents (see e.g., U.S. Pat. Nos. 5,756,065; 5,714,631; 5,696,239; 5,652,361; 5,505,931; 5,489,425; 5,435,990; 5,428,139; 5,342,604; 5,274,119; 4,994,560; and 5,808,003). Aside from the above assays, various in vivo and ex vivo assays are available to the skilled practitioner. For example, one can expose cells within the body of the subject to an anti-E7MC antibody moiety which is optionally labeled with a detectable label, e.g., a radioactive isotope, and binding of the anti-E7MC antibody moiety to the cells can be evaluated, e.g., by external scanning for radioactivity or by analyzing a sample {e.g., a biopsy or other biological sample) derived from a subject previously exposed to the anti-E7MC antibody moiety.
Articles of Manufacture and Kits
[0541] In some embodiments of the invention, there is provided an article of manufacture containing materials useful for the treatment of an HPV16-E7-positive disease such as cancer (for example squamous cell carcinoma, cervical cancer, anal cancer, vaginal cancer, vulvar cancer, penile cancer, head and neck cancer, or oropharyngeal cancer), for delivering an anti- E7MC construct to a cell presenting an E7MC on its surface, or for isolation or detection of E7MC-presenting cells in an individual. The article of manufacture can comprise a container and a label or package insert on or associated with the container. Suitable containers include, for example, bottles, vials, syringes, etc. The containers may be formed from a variety of materials such as glass or plastic. Generally, the container holds a composition which is effective for treating a disease or disorder described herein, and may have a sterile access port
(for example the container may be an intravenous solution bag or a vial having a stopper pierceable by a hypodermic injection needle). At least one active agent in the composition is an anti-E7MC construct of the invention. The label or package insert indicates that the composition is used for treating the particular condition. The label or package insert will further comprise instructions for administering the anti-E7MC construct composition to the patient. Articles of manufacture and kits comprising combinatorial therapies described herein are also contemplated.
[0542] Package insert refers to instructions customarily included in commercial packages of therapeutic products that contain information about the indications, usage, dosage, administration, contraindications and/or warnings concerning the use of such therapeutic products. In some embodiments, the package insert indicates that the composition is used for treating HPV16-E7-positive cancer (such as squamous cell carcinoma, cervical cancer, anal cancer, vaginal cancer, vulvar cancer, penile cancer, head and neck cancer, or oropharyngeal cancer).
[0543] Additionally, the article of manufacture may further comprise a second container comprising a pharmaceutically-acceptable buffer, such as bacteriostatic water for injection (BWFI), phosphate-buffered saline, Ringer's solution and dextrose solution. It may further include other materials desirable from a commercial and user standpoint, including other buffers, diluents, filters, needles, and syringes.
[0544] Kits are also provided that are useful for various purposes, e.g. , for treatment of an HPV16-E7-positive disease or disorder described herein, for delivering an anti-E7MC construct to a cell presenting an E7MC on its surface, or for isolation or detection of E7MC- presenting cells in an individual, optionally in combination with the articles of manufacture. Kits of the invention include one or more containers comprising an anti-E7MC construct composition (or unit dosage form and/or article of manufacture), and in some embodiments, further comprise another agent (such as the agents described herein) and/or instructions for use in accordance with any of the methods described herein. The kit may further comprise a description of selection of individuals suitable for treatment. Instructions supplied in the kits of the invention are typically written instructions on a label or package insert (e.g. , a paper sheet included in the kit), but machine-readable instructions (e.g. , instructions carried on a magnetic or optical storage disk) are also acceptable.
[0545] For example, in some embodiments, the kit comprises a composition comprising an anti-E7MC construct (e.g. , a full-length anti-E7MC antibody, a multi- specific anti-E7MC
molecule (such as a bispecific anti-E7MC antibody), or an anti-E7MC immunoconjugate). In some embodiments, the kit comprises a) a composition comprising an anti-E7MC construct, and b) an effective amount of at least one other agent, wherein the other agent increases the expression of MHC class I proteins and/or enhances the surface presentation of HPV16-E7 peptides by MHC class I proteins (e.g. , IFNy, IFNP, IFNa, or Hsp90 inhibitor). In some embodiments, the kit comprises a) a composition comprising an anti-E7MC construct, and b) instructions for administering the anti-E7MC construct composition to an individual for treatment of an HPV16-E7-positive disease, including for example squamous cell carcinoma, cervical cancer, or anal cancer. In some embodiments, the kit comprises a) a composition comprising an anti-E7MC construct, b) an effective amount of at least one other agent, wherein the other agent increases the expression of MHC class I proteins and/or enhances the surface presentation of HPV16-E7 peptides by MHC class I proteins (e.g. , IFNy, IFNP, IFNa, or Hsp90 inhibitor), and c) instructions for administering the anti-E7MC construct composition and the other agent(s) to an individual for treatment of an HPV16-E7-positive disease, including for example squamous cell carcinoma, cervical cancer, or anal cancer. The anti-E7MC construct and the other agent(s) can be present in separate containers or in a single container. For example, the kit may comprise one distinct composition or two or more compositions wherein one composition comprises an anti-E7MC construct and another composition comprises another agent.
[0546] In some embodiments, the kit comprises a) a composition comprising an anti-E7MC construct (e.g. , a full-length anti-E7MC antibody, a multi- specific anti-E7MC molecule (such as a bispecific anti-E7MC antibody), or an anti-E7MC immunoconjugate), and b) instructions for combining the anti-E7MC construct with cells (such as cells, e.g. , immune cells, derived from an individual) to form a composition comprising anti-E7MC construct/cell conjugates and administering the anti-E7MC construct/cell conjugate composition to the individual for treatment of an HPV16-E7-positive disease (including for example squamous cell carcinoma, cervical cancer, or anal cancer). In some embodiments, the kit comprises a) a composition comprising an anti-E7MC construct, and b) a cell (such as a cytotoxic cell). In some embodiments, the kit comprises a) a composition comprising an anti-E7MC construct, b) a cell (such as a cytotoxic cell), and c) instructions for combining the anti-E7MC construct with the cell to form a composition comprising anti-E7MC construct/cell conjugates and administering the anti-E7MC construct/cell conjugate composition to an individual for the treatment of an HPV16-E7-positive disease, including for example squamous cell carcinoma,
cervical cancer, or anal cancer. In some embodiments, the kit comprises a composition comprising an anti-E7MC construct in association with a cell (such as a cytotoxic cell). In some embodiments, the kit comprises a) a composition comprising an anti-E7MC construct in association with a cell (such as a cytotoxic cell), and b) instructions for administering the composition to an individual for the treatment of an HPV16-E7-positive disease, including for example squamous cell carcinoma, cervical cancer, or anal cancer. In some embodiments, the association is by conjugation of the anti-E7MC construct to a molecule on the surface of the cell. In some embodiments, the association is by insertion of a portion of the anti-E7MC construct into the outer membrane of the cell.
[0547] In some embodiments, the kit comprises a nucleic acid (or set of nucleic acids) encoding an anti-E7MC construct (e.g. , a full-length anti-E7MC antibody, a multi- specific anti-E7MC molecule (such as a bispecific anti-E7MC antibody), an anti-E7MC CAR, or an anti-E7MC immunoconjugate) or polypeptide portions thereof. In some embodiments, the kit comprises a) a nucleic acid (or set of nucleic acids) encoding an anti-E7MC construct or polypeptide portions thereof, and b) a host cell (such as an effector cell) for expressing the nucleic acid (or set of nucleic acids). In some embodiments, the kit comprises a) a nucleic acid (or set of nucleic acids) encoding an anti-E7MC construct or polypeptide portions thereof, and b) instructions for i) expressing the anti-E7MC construct in a host cell (such as an effector cell, e.g. , a T cell), ii) preparing a composition comprising the anti-E7MC construct or the host cell expressing the anti-E7MC construct, and iii) administering the composition comprising the anti-E7MC construct or the host cell expressing the anti-E7MC construct to an individual for the treatment of an HPV16-E7-positive disease, including for example squamous cell carcinoma, cervical cancer, or anal cancer. In some embodiments, the host cell is derived from the individual. In some embodiments, the kit comprises a) a nucleic acid (or set of nucleic acids) encoding an anti-E7MC construct or polypeptide portions thereof, b) a host cell (such as an effector cell) for expressing the nucleic acid (or set of nucleic acids), and c) instructions for i) expressing the anti-E7MC construct in the host cell, ii) preparing a composition comprising the anti-E7MC construct or the host cell expressing the anti-E7MC construct, and iii) administering the composition comprising the anti-E7MC construct or the host cell expressing the anti-E7MC construct to an individual for the treatment of an HPV16-E7-positive disease, including for example squamous cell carcinoma, cervical cancer, or anal cancer.
[0548] In some embodiments, the kit comprises a nucleic acid encoding an anti-E7MC CAR. In some embodiments, the kit comprises a vector comprising a nucleic acid encoding an anti-E7MC CAR. In some embodiments, the kit comprises a) a vector comprising a nucleic acid encoding an anti-E7MC CAR, and b) instructions for i) introducing the vector into effector cells, such as T cells derived from an individual, ii) preparing a composition comprising the anti-E7MC CAR effector cells, and iii) administering the anti-E7MC CAR effector cell composition to the individual for treatment of an HPV16-E7-positive disease, including for example squamous cell carcinoma, cervical cancer, or anal cancer.
[0549] The kits of the invention are in suitable packaging. Suitable packaging includes, but is not limited to, vials, bottles, jars, flexible packaging (e.g. , sealed Mylar or plastic bags), and the like. Kits may optionally provide additional components such as buffers and interpretative information. The present application thus also provides articles of manufacture, which include vials (such as sealed vials), bottles, jars, flexible packaging, and the like.
[0550] The instructions relating to the use of the anti-E7MC construct compositions generally include information as to dosage, dosing schedule, and route of administration for the intended treatment. The containers may be unit doses, bulk packages (e.g. , multi-dose packages) or sub-unit doses. For example, kits may be provided that contain sufficient dosages of an anti-E7MC construct (e.g. , a full-length anti-E7MC antibody, a multi- specific anti-E7MC molecule (such as a bispecific anti-E7MC antibody), an anti-E7MC CAR, or an anti-E7MC immunoconjugate) as disclosed herein to provide effective treatment of an individual for an extended period, such as any of a week, 8 days, 9 days, 10 days, 11 days, 12 days, 13 days, 2 weeks, 3 weeks, 4 weeks, 6 weeks, 8 weeks, 3 months, 4 months, 5 months, 7 months, 8 months, 9 months, or more. Kits may also include multiple unit doses of the anti- E7MC construct and pharmaceutical compositions and instructions for use and packaged in quantities sufficient for storage and use in pharmacies, for example, hospital pharmacies and compounding pharmacies.
EXEMPLARY EMBODIMENTS
[0551] Embodiment 1. In some embodiments, there is provided an isolated anti-E7MC construct comprising an antibody moiety that specifically binds to a complex comprising human papilloma virus subtype 16 (HPV16) E7 peptide and a major histocompatibility (MHC) class I protein (an HPV16-E7/MHC class I complex, or E7MC).
[0552] Embodiment 2. In some further embodiments of embodiment 1, the HPV16- E7/MHC class I complex is present on a cell surface.
[0553] Embodiment 3. In some further embodiments of embodiment 1, the HPV16- E7/MHC class I complex is present on the surface of a cancer cell.
[0554] Embodiment 4. In some further embodiments of any one of embodiments 1-3, the MHC class I protein is human leukocyte antigen (HLA)-A.
[0555] Embodiment 5. In some further embodiments of embodiment 4, the MHC class I protein is HLA-A02.
[0556] Embodiment 6. In some further embodiments of embodiment 5, the MHC class I protein is selected from the group consisting of HLA-A*02:01, HLA-A*02:02, HLA- A*02:06, HLA-A*02:07, and HLA-A*02: 11.
[0557] Embodiment 7. In some further embodiments of embodiment 6, the MHC class I protein is HLA-A*02:01
[0558] Embodiment 8. In some further embodiments of any one of embodiments 1-7, the antibody moiety cross-reacts with a complex comprising the HPV16-E7 peptide and a second MHC class I protein having a different HLA allele than the MHC class I protein.
[0559] Embodiment 9. In some further embodiments of any one of embodiments 1-8, the HPV16-E7 peptide is 8 to 12 amino acids in length.
[0560] Embodiment 10. In some further embodiments of any one of embodiments 1-9, the HPV16-E7 peptide is derived from the E7 protein of human papilloma virus subtype 16.
[0561] Embodiment 11. In some further embodiments of any one of embodiments 1-10, the HPV16-E7 peptide has an amino acid sequence selected from the group consisting of SEQ ID NOs: 3-14.
[0562] Embodiment 12. In some further embodiments of embodiment 10, the HPV16-E7 peptide has the amino acid sequence of YMLDLQPET (SEQ ID NO: 4).
[0563] Embodiment 13. In some further embodiments of embodiment 12, the isolated anti- E7MC construct cross-reacts with a complex comprising a variant of the HPV16-E7 peptide having the amino acid sequence of YMLDVQPET (SEQ ID NO: 11) and the MHC class I protein.
[0564] Embodiment 14. In some further embodiments of any one of embodiments 1-13, the antibody moiety is human, humanized, or semi-synthetic.
[0565] Embodiment 15. In some further embodiments of any one of embodiments 1-14, the antibody moiety is a full-length antibody, a Fab, a Fab', a (Fab')2, an Fv, or a single chain Fv (scFv).
[0566] Embodiment 16. In some further embodiments of any one of embodiments 1-15, the antibody moiety binds to the HPV16-E7/MHC class I complex with an equilibrium dissociation constant (Kd) from about 0.1 pM to about 500 nM.
[0567] Embodiment 17. In some further embodiments of any one of embodiments 1-16, the isolated anti-E7MC construct binds to the HPV16-E7/MHC class I complex with a Kd from about 0.1 pM to about 500 nM.
[0568] Embodiment 18. In some further embodiments of any one of embodiments 1-17, the antibody moiety comprises:
i) a heavy chain variable domain comprising a heavy chain complementarity determining region (HC-CDR) 1 comprising the amino acid sequence of G-F/G/Y-S/T-F-S/T- S-Y-A/G (SEQ ID NO: 183), or a variant thereof comprising up to about 3 amino acid substitutions, an HC-CDR2 comprising the amino acid sequence of I-N/I-P-X-X-G-G/T/I- T/A/P or I-S-X-S/D-G/N-G/S-N-T/I/K (SEQ ID NO: 184 or 185), or a variant thereof comprising up to about 3 amino acid substitutions, and an HC-CDR3 comprising the amino acid sequence of any one of A-R-S/R-Y/S/G-Y/V-Y/W-G-X-Y-D, A-R-G-X-X-X-Y-Y/G/S, or A-R-G-X-X-Y-QAV-W-S-X-D-D (SEQ ID NOs: 186-188), or a variant thereof comprising up to about 3 amino acid substitutions; and
ii) a light chain variable domain comprising a light chain complementarity determining region (LC-CDR) 1 comprising the amino acid sequence of N-I-G-S-N/K or L- R-S/N-X-Y (SEQ ID NO: 189 or 190), or a variant thereof comprising up to about 3 amino acid substitutions, and an LC-CDR3 comprising the amino acid sequence of A/Q/N-S/A/V- W/Y/R-D-S/D-S-L/S/G-X-X-X-V (SEQ ID NO: 191), or a variant thereof comprising up to about 3 amino acid substitutions, wherein X can be any amino acid.
[0569] Embodiment 19. In some further embodiments of any one of embodiments 1-17, the antibody moiety comprises:
i) a heavy chain variable domain comprising an HC-CDR1 comprising the amino acid sequence of any one of SEQ ID NOs: 57-77, or a variant thereof comprising up to about 5 amino acid substitutions, an HC-CDR2 comprising the amino acid sequence of any one of SEQ ID NOs: 78-98, or a variant thereof comprising up to about 5 amino acid substitutions, and an HC-CDR3 comprising the amino acid sequence of any one of SEQ ID NOs: 99-119, 244, and 245; or a variant thereof comprising up to about 5 amino acid substitutions; and ii) a light chain variable domain comprising an LC-CDR1 comprising the amino acid sequence of any one of SEQ ID NOs: 120-140 and 246, or a variant thereof comprising up to about 5 amino acid substitutions, an LC-CDR2 comprising the amino acid sequence of any one of SEQ ID NOs: 141-161, or a variant thereof comprising up to about 3 amino acid substitutions, and an LC-CDR3 comprising the amino acid sequence of any one of SEQ ID NOs: 162-182 and 247-250; or a variant thereof comprising up to about 5 amino acid substitutions.
[0570] Embodiment 20. In some further embodiments of any one of embodiments 1-17, the antibody moiety comprises:
i) a heavy chain (HC) variable domain comprising an HC-CDR1 comprising the amino acid sequence of any one of SEQ ID NOs: 57-77, an HC-CDR2 comprising the amino acid sequence of any one of SEQ ID NOs: 78-98, and an HC-CDR3 comprising the amino acid sequence of any one of SEQ ID NOs: 99-119, 244, and 245; or a variant thereof comprising up to about 5 amino acid substitutions in the HC-CDR regions; and
ii) a light chain (LC) variable domain comprising an LC-CDR1 comprising the amino acid sequence of any one of SEQ ID NOs: 120-140 and 246, an LC-CDR2 comprising the amino acid sequence of any one of SEQ ID NOs: 141-161, and an LC-CDR3 comprising the amino acid sequence of any one of SEQ ID NOs: 162-182 and 247-250; or a variant thereof comprising up to about 5 amino acid substitutions in the LC-CDR regions.
[0571] Embodiment 21. In some further embodiments of embodiment 19 or 20, the antibody moiety comprises a) a heavy chain variable domain comprising the amino acid sequence of any one of SEQ ID NOs: 15-35 and 233-237, or a variant thereof having at least about 95% sequence identify to any one of SEQ ID NOs: 15-35 and 233-237; and b) a light chain variable domain comprising the amino acid sequence of any one of SEQ ID NOs: 36-
56 and 238-243, or a variant thereof having at least about 95% sequence identity to any one of SEQ ID NOs: 36-56 and 238-243.
[0572] Embodiment 22. In some further embodiments of embodiment 21, the antibody moiety comprises a heavy chain variable domain comprising the amino acid sequence of any one of SEQ ID NOs: 15-35 and 233-237 and a light chain variable domain comprising the amino acid sequence of any one of SEQ ID NOs: 36-56 and 238-243.
[0573] Embodiment 23. In some further embodiments of any one of embodiments 1-22, the isolated anti-E7MC construct is a full-length antibody.
[0574] Embodiment 24. In some further embodiments of any one of embodiments 1-23, the isolated anti-E7MC construct is monospecific.
[0575] Embodiment 25. In some further embodiments of any one of embodiments 1-23, the isolated anti-E7MC construct is multispecific.
[0576] Embodiment 26. In some further embodiments of embodiment 25, the isolated anti- E7MC construct is bispecific.
[0577] Embodiment 27. In some further embodiments of embodiment 25 or 26, the isolated anti-E7MC construct is a tandem scFv, a diabody (Db), a single chain diabody (scDb), a dual- affinity retargeting (DART) antibody, a dual variable domain (DVD) antibody, a knob-into- hole (KiH) antibody, a dock and lock (DNL) antibody, a chemically cross-linked antibody, a heteromultimeric antibody, or a heteroconjugate antibody.
[0578] Embodiment 28. In some further embodiments of embodiment 27, the isolated anti- E7MC construct is a tandem scFv comprising two scFvs linked by a peptide linker.
[0579] Embodiment 29. In some further embodiments of embodiment 28, the peptide linker comprises the amino acid sequence GGGGS.
[0580] Embodiment 30. In some further embodiments of any one of embodiments 25-29, the isolated anti-E7MC construct further comprises a second antibody moiety that
specifically binds to a second antigen.
[0581] Embodiment 31. In some further embodiments of embodiment 30, the second antigen is an antigen on the surface of a T cell.
[0582] Embodiment 32. In some further embodiments of embodiment 31, the second antigen is selected from the group consisting of CD3y, CD35, CD3s, CD3C, CD28, OX40, GITR, CD137, CD27, CD40L and HVEM.
[0583] Embodiment 33. In some further embodiments of embodiment 31, the second antigen is CD3s, and wherein the isolated anti-E7MC construct is a tandem scFv comprising
an N-terminal scFv specific for the HPV16-E7/MHC class I complex and a C-terminal scFv specific for CD3s.
[0584] Embodiment 34. In some further embodiments of embodiment 31, the T cell is selected from the group consisting of a cytotoxic T cell, a helper T cell, and a natural killer T cell.
[0585] Embodiment 35. In some further embodiments of embodiment 30, the second antigen is an antigen on the surface of a natural killer cell, a neutrophil, a monocyte, a macrophage or a dendritic cell.
[0586] Embodiment 36. In some further embodiments of any one of embodiments 1-22, the isolated anti-E7MC construct is a chimeric antigen receptor.
[0587] Embodiment 37. In some further embodiments of embodiment 36, the chimeric antigen receptor comprises an extracellular domain comprising the antibody moiety, a transmembrane domain, and an intracellular signaling domain comprising a CD3ζ intracellular signaling sequence and a CD28 intracellular signaling sequence.
[0588] Embodiment 38. In some further embodiments of any one of embodiments 1-22, the isolated anti-E7MC construct is an immunoconjugate comprising the antibody moiety and an effector molecule.
[0589] Embodiment 39. In some further embodiments of embodiment 37, the effector molecule is a therapeutic agent selected from the group consisting of a drug, a toxin, a radioisotope, a protein, a peptide, and a nucleic acid.
[0590] Embodiment 40. In some further embodiments of embodiment 39, the therapeutic agent is a drug or a toxin.
[0591] Embodiment 41. In some further embodiments of embodiment 38, the effector molecule is a label.
[0592] Embodiment 42. In some embodiments, there is provided a pharmaceutical composition comprising the isolated anti-E7MC construct of any one of embodiments 1-40.
[0593] Embodiment 43. In some embodiments, there is provided a host cell expressing the isolated anti-E7MC construct of any one of embodiments 1-41.
[0594] Embodiment 44. In some embodiments, there is provided a nucleic acid encoding the polypeptide components of the isolated anti-E7MC construct of any one of embodiments 1-41.
[0595] Embodiment 45. In some embodiments, there is provided a vector comprising the nucleic acid of embodiment 44.
[0596] Embodiment 46. In some embodiments, there is provided an effector cell expressing the isolated anti-E7MC construct of embodiment 36 or 37.
[0597] Embodiment 47. In some further embodiments of embodiment 46, the effector cell is a T cell.
[0598] Embodiment 48. In some embodiments, there is provided a method for detecting a cell presenting a complex comprising an HPV16-E7 peptide and an MHC class I protein on its surface, comprising contacting the cell with the isolated anti-E7MC construct of embodiment 41 and detecting the presence of the label on the cell.
[0599] Embodiment 49. In some embodiments, there is provided a method for treating an individual having an HPV16-E7-positive disease, comprising administering to the individual an effective amount of the pharmaceutical composition of embodiment 42.
[0600] Embodiment 50. In some embodiments, there is provided a method for treating an individual having an HPV16-E7-positive disease, comprising administering to the individual an effective amount of the effector cell of embodiment 46 or 47.
[0601] Embodiment 51. In some embodiments, there is provided a method of diagnosing an individual having an HPV16-E7-positive disease, comprising:
a) administering an effective amount of the isolated anti-E7MC construct of embodiment 41 to the individual; and
b) determining the level of the label in the individual, wherein a level of the label above a threshold level indicates that the individual has the HPV16-E7-positive disease.
[0602] Embodiment 52. In some embodiments, there is provided a method of diagnosing an individual having an HPV16-E7-positive disease, comprising:
a) contacting a sample derived from the individual with the isolated anti-E7MC construct of embodiment 41; and
b) determining the number of cells bound with the isolated anti-E7MC construct in the sample, wherein a value for the number of cells bound with the isolated anti-E7MC construct above a threshold level indicates that the individual has the HPV16-E7-positive disease.
[0603] Embodiment 53. In some further embodiments of embodiments 49-52, the HPV16- E7-positive disease is HPV16-E7-positive cancer.
[0604] Embodiment 54. In some further embodiments of embodiment 53, the HPV16-E7- positive cancer is squamous cell carcinoma.
[0605] Embodiment 55. In some further embodiments of embodiment 53, the HPV16-E7- positive cancer is cervical cancer, anogenital cancer, head and neck cancer, or oropharyngeal cancer.
EXAMPLES
[0606] Those skilled in the art will recognize that several embodiments are possible within the scope and spirit of this invention. The invention will now be described in greater detail by reference to the following non-limiting examples. The following examples further illustrate the invention but, of course, should not be construed as in any way limiting its scope.
Materials
Cell Samples, Cell Lines, and Antibodies
[0607] The cell lines include: CaSki (ATCC CRL- 1550; HLA-A2+, HPV16+), head and neck squamous cell carcinoma cell line UM-SCC-104 (Millipore; HLA-A2+, HPV16+), liver adenocarcinoma cell line SK-HEP-1 (ATCC HTB-52; HLA-A2+, HPV16 ), cervical squamous cell carcinoma cell line SiHa (ATCC HTB-35; HLA-A2", HPV16+), cervical cancer cell line C33A (ATCC HTB-31; HLA-A2+, HPV16"), cervical carcinoma cell line MS-751 (ATCC HTB-34; HLA-A2+, HPV16 ), cervical adenocarcinoma cell line HeLa (ATCC CCL-2; HLA-A2", HPV16"), hepatocellular carcinoma cell line Hep3B (ATCC HB- 8064; HLA-A2", HPV16"), hepatocellular carcinoma cell line HepG2 (ATCC HB-8065; HLA-A2", HPV16"), lymphoma cell line Raji (ATCC CCL-86; HLA-A2", HPV16"), T cell leukemia cell line Jurkat (ATCC TIB-152; HLA-A2", HPV16"), lymphoma cell line Daudi (ATCC CCL-213; HPA-A2", HPV16"), leukemia cell line K562 (ATCC CCL-243; HLA-A2", HPV16"), and lymphoblast cell line T2 (ATCC CRL-1992; HLA-A2+, HPV16"). T2 is a TAP- deficient cell line. The cell lines were cultured in RPMI 1640 supplemented with 5% FCS, penicillin, streptomycin, 2 mmol/L glutamine, and 2-mercaptoethanol at 37° C/5% C02.
[0608] All peptides were purchased and synthesized by Genemed Synthesis, Inc. (San Antonio, Tex.). Peptides were >90% pure. The peptides were dissolved in DMSO and diluted in saline at 5 mg/mL and frozen at -180 C. Biotinylated single chain HPV16-E7
peptide/HLA-A*02:01 and control peptides/HLA-A*02:01 complexes were synthesized by refolding the peptides with recombinant HLA-A02 and beta-2 microglobulin (β2Μ) (~2M). 11 control peptides (SEQ ID NOs: 193-203) that bind HLA-A*02:01 were generated from
the following 10 genes: BCR, BTG2, CALR, CD247, CTSG, DDX5, HLA-E, IFI30, PPP2R1B, SSR1.
Example 1. Production of biotinylated HPV16-E7/HLA-A*02:01 complex monomer
[0609] Biotinylated HPV16-E7/HLA-A*02:01 complex monomers were prepared according to standard protocols (John D. Altman and Mark M. Davis, Current Protocols in Immunology 17.3.1-17.3.33, 2003). In brief, DNA encoding full-length human beta-2 microglobulin (β2ιη) was synthesized by Genewiz and cloned into vector pET-27b. The BirA substrate peptide (BSP) was added to the C-terminus of HLA-A*02:01 extracellular domain (ECD). DNA encoding HLA-A*02:01 ECD-BSP was also synthesized by Genewiz and cloned into vector pET-27b. The vectors expressing human β2ιη and HLA-A*02:01 ECD- BSP were transformed into E.coli BL21 cells separately, and expressed proteins were isolated as inclusion bodies from bacterial culture. Peptide ligand HPV16-E7 peptide 11-19 was refolded with human p2m and HLA-A*02:01 ECD-BSP to form HPV16-E7 peptide/HLA- A*02:01 complex monomer. Folded peptide/HLA-A*02:01 monomers were concentrated by ultrafiltration and further purified through size-exclusion chromatography. HiPrep 26/60 Sephacryl S-300 HR was equilibrated with 1.5 column volumes of Hyclone Dulbecco's Phosphate Buffered Saline solution (Thermo Scientific, Cat No. SH3002802). The unpurified sample was loaded and eluted with 1 column volume. The first peak, corresponding to misfolded aggregates, eluted at approximately 111 mL, the peak corresponding to the properly folded MHC complex was observed at 212 mL, and the peak corresponding to free β2Μ was observed at 267 mL (FIG. 1). Peptide/HLA-A*02:01 monomers were biotinylated via BirA-mediated enzymatic reaction and subsequently purified by high-resolution anion- exchange chromatography. Biotinylated peptide/HLA-A*02:01 monomers were stored in PBS at -80°C.
[0610] SDS-PAGE of the purified HPV16-E7 peptide/MHC complex can be performed to determine protein purity. For example, ^g of the protein complex is mixed with 2.5μί of the NuPAGE LDS Sample Buffer (Life Technologies, NP0008) and brought up to ΙΟμί with deionized water. The sample is heated at 70°C for 10 minutes, and then loaded onto the gel. Gel electrophoresis is performed at 180V for 1 hour.
Example 2. Selection and Characterization of scFv Specific for HPV16-E7/HLA- A*02:01 Complexes.
[0611] A collection of human scFv antibody phage display libraries (diversity = lOxlO10) constructed by Eureka Therapeutics was used for the selection of human mAbs specific to HPV16-E7/HLA-A*02:01. 15 fully human phage scFv libraries were used to pan against HPV16-E7/HLA-A*02:01 complex. In order to reduce the conformational change of MHCI complex introduced by immobilizing the protein complex onto plastic surfaces, solution panning and cell panning were used in place of conventional plate panning. In solution panning, biotinylated antigens were first mixed with the human scFv phage library after extended washing with PBS buffer, and then antigen- scFv antibody phage complexes were pulled down by streptavidin-conjugated Dynabeads M-280 through a magnetic rack. The bound clones were then eluted and used to infect E.coli XLl-Blue cells. In cell panning, T2 cells loaded with HPV16-E7 peptide were first mixed with the human scFv phage library. T2 cells are a TAP-deficient, HLA-A*02:01+ lymphoblast cell line. To load peptide, T2 cells were pulsed with peptides (50ug/ml) in serum- free RPMI1640 medium in the presence of 20 μg/ml β2Μ overnight. After extended washing with PBS, peptide-loaded T2 cells with bound scFv antibody phage were spun down. The bound clones were then eluted and used to infect E.coli XLl-Blue cells. The phage clones expressed in bacteria were then purified. The panning was performed for 3-4 rounds with either solution panning, cell panning or a combination of solution and cell panning to enrich for scFv phage clones that bound HPV 16- E7/ HLA-A*02:01 specifically.
[0612] Streptavidin ELISA plates were coated with biotinylated HPV 16-E7 11-19 peptide/HLA-A*02:01 complex monomer or biotinylated C3 control peptide/HLA-A*02:01 monomer respectively. C3 peptide is human nuclear protein p68-derived peptide
YLLPAIVHI (SEQ ID NO: 193). Individual phage clones from enriched phage display panning pools against HPV16-E7 11-19 peptide/HLA-A*02:01 complex were incubated in the coated plates. Binding of the phage clones was detected by HRP-conjugated anti-M13 antibodies and developed using HRP substrate. The absorbance was read at 450nm. 145 positive clones were identified through ELISA screening of 1272 phage clones enriched from phage panning. FIG. 2 provides an example of phage clone binding to biotinylated HPV 16-
E7/HLA-A*02:01 monomer in an ELISA assay. 41 unique clones were identified by DNA sequencing of the 145 ELISA-positive phage clones. Specific and unique clones were further tested for their binding to HLA-A*02:01/peptide complexes on live cell surface by flow
cytometry (FACS analysis) using HPV16-E7-loaded live T2 cells. FIG. 3 demonstrates binding of exemplar positive clones to HPV16-E7 11-19 peptide-loaded T2 cells or control peptide (C3 peptide)-loaded T2 cells. Controls included T2 cells without peptide loading (cell only) and R-PE conjugated horse anti-mouse IgG control (secondary antibody only). In brief, T2 cells loaded with HPV16-E7 11-19 peptide or C3 peptide were first stained with purified scFv phage clones, followed by a second staining with mouse anti-M13 mAb, and a third staining with R-PE conjugated horse anti-mouse IgG from Vector Labs. Each staining step was performed for between 30-60 minutes on ice and the cells were washed twice between stainings. Among the 41 clones tested, 24 recognized HPV16-E7-loaded T2 cells specifically. These 24 phage clones specifically bound to HPV16-E7-loaded T2 cells and did not recognize T2 cells loaded with C3 peptide in the context of HLA-A*02:01, or T2 cells without peptide loaded.
Example 3. Characterization of FACS-positive HPV16-E7-specific phage clones
Cross-reactivity to HPV16-E7 peptide 11-19 variants
[0613] The HPV16-E7 11-19 peptide selected in this invention is highly conserved among various HPV16 strains. In one study, this peptide was found to be fully conserved in 16 of 17 known HPV16-E7 protein sequences. A single amino acid mutation within E7 11-19 was identified in the remaining sequence. This variant was then found in 1 of 35 HPV16 infected cervical cancer or cervicitis patients analyzed (Zhang G.L. et al., Database (Oxford).
2014:bau031, 2014). Clones selected from FACS binding analysis against HPV16-E7 peptide 11-19-loaded T2 cells are characterized further for cross-reactivity towards this HPV16-E7 peptide 11-19 variant/HLA-A*02:01 complex on live cell surfaces by FACS analysis using variant HPV16-E7 peptide-loaded live T2 cells. The variant peptide differs from the conserved HPV16-E7 11-19 peptide by a single amino acid at position 5. The variant peptide sequence is YMLDVQPET (SEQ ID NO: 11), while the conserved HPV16-E7 11-19 sequence is YMLDLQPET (SEQ ID NO: 4).
[0614] In brief, T2 cells are loaded with the conserved HPV16-E7 11-19 peptide, the variant HPV16-E7 11-19 peptide, or β2Μ. The peptide-loaded T2 cells are stained with purified scFv phage clones, followed by a second staining with a mouse anti-M13 mAb and a third staining with R-PE conjugated horse anti-mouse IgG from Vector Labs. Each staining step is performed on ice for 30-60 minutes and the cells are washed twice between each staining.
Epitope mapping by alanine walking
[0615] To investigate with precision the epitope for the rnAb recognition, HPV16-E7 peptides with alanine substitutions at positions 1, 5 and 8 were pulsed onto T2 cells.
Antibody phage clones were then tested for binding to these peptide-loaded T2 cells by FACS analysis. FACS mean fluorescent intensity (MFI) values of each FACS assay are shown in table 6. K07 helper phage is a negative control showing that the phage alone without scFv presentation on the phage particle surface does not bind to any of the peptide- loaded T2 cell groups. Antibody BB7.2 recognizes the HLA-A02 alpha chain. Peptide binding to MHC complex stabilizes cell-surface MHC complexes. Therefore, T2 cells loaded with MHC-binding peptide have enhanced BB7.2 binding signal compared to T2 cells without peptide loading (as shown in the first row of table 6). BB7.2 binding data indicate that the alanine-substituted peptides are still able to bind HLA-A*02:01 molecules on the T2 cell surface. Although all the antibodies tested recognized the small conformational epitope formed by the HPV16-E7 peptide and its surrounding MHC alpha chain residues, the key peptide residues interacting with the various antibodies were quite different. For example, clone #4 is predicted to bind to the N-terminal half of the HPV16-E7 peptide since alanine substitution at position 1 or 5 dramatically reduced binding to the peptide-loaded T2 cells. In contrast, alanine substitutions at position 8 did not change the binding of the same clone to the HLA-A*02:01 complex. Clone #11, on the other hand, was insensitive to alanine substitution at position 1 and 8, but alanine substitution at position 5 completely abrogated its binding. FIG. 4 provides an example of FACS analysis, showing the binding of phage clone #11 to T2 cells loaded with the various HPV16-E7 peptides. Controls included T2 cells without peptide loading (cell only) and R-PE conjugated horse anti-mouse IgG control (secondary antibody only). Antibody binding to T2 cells loaded with these different peptides were tested by FACS assays.
Table 6
Antibody binding specificity evaluation against endogenous peptide
[0616] On average, each nucleated cell in the human body expresses about half a million different peptide/MHC Class I complexes. In order to develop anti-peptide/MHCI-complex antibodies into anti-cancer drugs with high specificity and therapeutic index, it is essential for the antibodies to specifically recognize the target peptide/MHCI complex, but not the MHCI molecule itself, or MHCI molecules bound to other peptides presented on cell surfaces. For the current study, the relevant MHCI molecule is HLA-A*02:01. During the early stages of our phage panning and screening, we eliminated antibodies that bound to the HLA-A*02:01 molecule alone (see, for example, FIGs. 2 and 3). The top phage clones were also screened against 11 endogenous HLA-A*02:01 peptides, which were derived from proteins normally expressed in multiple types of nucleated human cells, such as globin alpha chain, beta chain, nuclear protein p68, and the like. Recombinant peptide/HLA-A*02:01 complexes folded with 11 endogenous peptides (Table 7, SEQ ID NOs: 193-203) separately were coated on streptavidin plates and antibody binding was determined through ELISA analysis. In brief, individual phage clones were incubated on the peptide/HLA-A*02:01 complex-coated plates. Binding of the phage clones was detected by HRP-conjugated anti-M13 antibodies and developed using HRP substrate. The absorbance was read at 450nm. As shown in FIG. 5, the HPV16-E7 peptide/HLA-A*02:01 -specific antibody phage clones bound HPV16-E7 peptide/HLA-A*02:01 complex, but not HLA-A*02:01 complexes folded with endogenous peptides. We conclude that the identified antibodies are specific to HPV16-E7 peptide/HLA-
A*02:01 complexes, and do not recognize HLA-A*02:01 molecules bound to other HLA- A*02:01 -restricted peptides.
Table 7
Example 4. Engineering bispecific antibodies
[0617] Bispecific antibodies (BsAbs) were generated using scFv sequences of the HPV16- E7/HLA-A*02:01-specific phage clones. The BsAbs are single-chain bispecific antibodies comprising the scFv sequence of an HPV16-E7/HLA-A*02:01-specific phage clone at the N- terminal end and an anti-human CD3s mouse monoclonal scFv at the C-terminal end
(Brischwein, K. et al., Molecular Immunology 43: 1129-1143, 2006). DNA fragments coding for the HPV16-E7 scFv and the anti-human CD3s scFv were synthesized by Genewiz and subcloned into Eureka's mammalian expression vector pGSN-Hyg using standard DNA techniques. A hexhistamine tag was inserted at the C-terminal end for antibody purification and detection. Chinese hamster ovary (CHO) cells were transfected with the BsAb expression vector, and then cultured for 7 days for BsAb antibody production. CHO cell supernatants containing secreted HPV16-E7 BsAb molecules were collected. BsAbs were purified using HisTrap HP column (GE healthcare) by FPLC AKTA system. Briefly, CHO cell culture was clarified and loaded onto the column with low imidazole concentration (20 mM), and then an isocratic high imidazole concentration elution buffer (500 mM) was used to elute the bound BsAb proteins. Purity and molecular weight of the purified HPV16-E7 BsAbs was determined under reducing conditions by gel electrophoresis. 4μg of the protein was mixed with 2.5μΕ of the NuPAGE LDS Sample Buffer (Life Technologies, NP0008) and brought
up to ΙΟμΙ^ with deionized water. The sample was heated at 70°C for 10 minutes, and then loaded onto the gel. Gel electrophoresis was performed at 180V for 1 hour. -50 KD bands are observed as the major bands on the gel (FIG. 6).
[0618] Antibody aggregation can be assessed by size-exclusion chromatography (SEC).
For example, 50μί of the sample is injected into a SEC column (for example
Agilent, BioSEC-3,300A, 4.6x300mm) while flowing a buffer consisting of Dulbecco's
Phosphate Buffered Saline (Fisher Scientific, SH30028.FS) and 0.2M arginine adjusted to pH
7.0. BsAbs with high molecular weight aggregation less than 10% are selected for further characterization.
Example 5. Characterization of HPV16-E7 BsAb antibodies
Binding affinity of HPV16-E7 BsAb antibodies
[0619] The binding affinity of HPV 16-E7 B s Ab antibodies to recombinant HPV 16- E7/HLA-A*02:01 complex is measured, for example, by Surface Plasma Resonance
(BiaCore). The binding parameters between the HPV16-E7 BsAb and the HPV 16-E7/HLA- A*02:01 complex are measured, for example, using a His Capture Kit (GE Healthcare, Cat# 28995056) on a Biacore X100 (GE Healthcare) according to the manufacturer's protocol for multi-cycle kinetics measurement. All of the proteins used in the assay are diluted using HBS-E buffer. For example, 1 μg/mL of the HPV16-E7 BsAb is immobilized onto a Sensor Chip pre-functionalized with the anti-histidine antibody by flowing the solution through the flow cell 2 at 2 μΕ/ηιίη for 2 minutes. Binding towards the HPV16-E7/A*02:01 complex is analyzed at, for example, 0.19, 0.38, 7.5, 15, and 30 μg/mL, each run consisting of a 3 minute association and 3 minute dissociation at 30 μΕ/ηιίη. At the end of cycle, the surface is regenerated using the regeneration buffer from the His Capture kit. Following the kinetics measurement, the surface is regenerated using the regeneration solution from the kit. The data are analyzed using 1: 1 binding site mode with the BiaCore X-100 evaluation software. The binding parameters (association on rate constant ka, dissociation constant kd, and equilibrium dissociation constant Kd) are then calculated.
T-cell killing assay with peptide-pulsed T2 cells
[0620] Tumor cytotoxicity was assayed by LDH Cytotoxicity Assay (Promega). Human T cells purchased from AllCells were activated and expanded with CD3/CD28 Dynabeads
(Invitrogen) according to manufacturer's protocol. Activated T cells (ATC) were cultured and maintained in RPMI1640 medium with 10% FBS plus 30 U/ml IL-2, and used at day 7-14.
The T cells were > 99% CD3+ by FACS analysis. Activated T cells (effector cells) and target peptide-loaded T2 cells were co-cultured at a 5: 1 ratio with 1 μg/ml or 0.2 μg/ml of BsAbs for 16 hours. Peptide-loaded T2 cells were prepared by incubating T2 cells overnight with 50 μg/ml of either the target HPV16-E7 11-19 peptide (YMLDLQPET, SEQ ID NO: 4) or negative control AFP158 peptide (FMNKFIYEI, SEQ ID NO: 192). A negative control AFP158/HLA-A*02:01 specific BsAb was also included. Cytotoxicities were determined by measuring LDH activities in culture supematants. As shown in FIG. 7, clones #2, #5, #17 and #40 killed the HPV16-E7 peptide-loaded T2 cells in a selective and dose-dependent manner. The negative control anti-AFP158/HLA-A*02:01 BsAb specifically directed killing of the AFP 158 peptide-loaded T2 cells.
T-cell killing assay with cancer cell lines
[0621] Tumor cytotoxicity was assayed by LDH Cytotoxicity Assay (Promega). Human T cells were purchased from AllCells and activated and expanded with CD3/CD28 Dynabeads (Invitrogen) according to manufacturer's protocol. Activated T cells (ATC) were cultured and maintained in RPMI1640 medium with 10% FBS plus 30 U/ml IL-2, and used at day 7-14. Activated T cells (effector cells) and target cancer cells were co-cultured at a 5: 1 ratio with different concentrations of BsAbs (including for example 0.2, 0.04, 0.008, and 0.0016 μg/ml BsAbs) for 16 hours. Cytotoxicities were then determined by measuring LDH activities in culture supematants.
[0622] Target cancer cells tested included cervical cancer cell line CaSki (ATCC CRL- 1550; HLA-A2+, HPV16+) and cervical carcinoma cell line MS-751 (ATCC HTB-34; HLA- A2+, HPV16"). As shown in FIG. 8A, multiple clones {e.g. 2, 41 and US-7) mediated selective killing of HPV-16+ cell line CaSki vs HPV-16" cell line MS-751 at 0.2 μg/ml BsAb. The BsAb-mediated killing of target-positive CaSki is dose-dependent as shown in FIG. 8B.
[0623] Additional target cancer cells that may be tested include head and neck squamous cell carcinoma cell line UM-SCC-104 (Millipore; HLA-A2+, HPV16+), liver adenocarcinoma cell line SK-HEP-1 (ATCC HTB-52; HLA-A2+, HPV16"), cervical squamous cell carcinoma cell line SiHa (ATCC HTB-35; HLA-A2", HPV16+), cervical cancer cell line C33A (ATCC
HTB-31; HLA-A2+, HPV16"), cervical adenocarcinoma cell line HeLa (ATCC CCL-2; HLA-
A2~, HPV16"), hepatocellular carcinoma cell line Hep3B (ATCC HB-8064; HLA-A2",
HPV16"), hepatocellular carcinoma cell line HepG2 (ATCC HB-8065; HLA-A2", HPV16"), lymphoma cell line Raji (ATCC CCL-86; HLA-A2", HPV16"), T cell leukemia cell line
Jurkat (ATCC TIB-152; HLA-A2", HPV16"), lymphoma cell line Daudi (ATCC CCL-213; HPA-A2", HPV16 ), and leukemia cell line K562 (ATCC CCL-243; HLA-A2", HPV16"). Cross-reactivity of HPV16-E7 BsAb antibodies against multiple HLA-A02 alleles
[0624] Human MHCI molecules consist of 6 class isoforms, HLA-A, -B, -C, -E, -F and G. The HLA-A, -B and-C heavy chain genes are highly polymorphic. For each isoform, the HLA genes are further grouped according to the similarity of heavy chain sequences. For example, HLA-A is divided into different alleles such as HLA-AOl, -A02, -A03, etc. For the HLA-A02 allele, there are multiple subtypes, such as HLA-A*02:01, A*02:02, etc. Between the different subtypes of HLA-A02 group, the sequence differences are limited to only several amino acids. So in many cases, peptides that bind to HLA-A*02:01 molecule can also form complexes with multiple subtypes of the HLA-A02 allele. As shown in Table 8 (http://www.allelefrequencies.net/), although HLA-A*02:01 is the dominant HLA-A02 subtype among Caucasian populations, in Asia, A*02:05, A*02:06, A*02:07 and A*02: l l are also common HLA-A02 subtypes. The ability of HPV16-E7 antibodies to recognize not only HPV16-E7 peptide in the context of HLA-A*02:01, but also other subtypes of HLA- A02, will greatly broaden the patient population that might be able to benefit from HPV16- E7 antibody drug treatment. To determine cross-reactivity, HPV16-E7/MHC class I complexes with other subtypes of the HLA-A02 allele are generated and the binding affinity of the HPV16-E7/HLA-A*02:01-specific antibodies for these other complexes is tested. Binding affinity is determined, for example, using a ForteBio Octet QK. Briefly, 5 μg/mL biotinylated HPV16-E7 peptide/HLA-A02 MHC complex having varying subtypes is loaded onto a streptavidin biosensor. After washing off excess antigen, BsAbs are tested at, for example, 10 μg/mL for association and dissociation kinetics. Binding parameters are calculated using a 1: 1 binding site, partial fit model.
Table 8
australia china europe india north sub- taiwan us africa saharan
africa
A*02:01 97.8% 39.5% 94.0% 53.9% 73.3% 56.3% 35.1% 79.4%
A*02:02 0.0% 0.1% 0.3% 0.9% 9.7% 24.1% 0.0% 3.6%
A*02:03 0.0% 15.3% 0.2% 4.9% 0.0% 0.4% 19.3% 2.2%
A*02:04 0.0% 0.1% 0.0% 0.3% 2.6% 0.4% 0.0% 0.2%
A*02:05 1.1% 0.9% 3.2% 5.8% 13.8% 15.9% 0.1% 4.5%
A*02:06 0.0% 16.0% 0.9% 10.6% 0.0% 0.7% 12.8% 5.5%
A*02:07 1.1% 26.1% 0.4% 0.4% 0.0% 0.0% 32.7% 2.4%
A*02:08 0.0% 0.0% 0.0% 0.0% 0.0% 0.0% 0.0% 0.0%
A*02:09 0.0% 0.0% 0.0% 0.0% 0.0% 0.0% 0.0% 0.0%
A*02:10 0.0% 1.1% 0.0% 0.0% 0.0% 0.2% 0.0% 0.1%
A*02:ll 0.0% 0.1% 0.1% 22.3% 0.0% 1.5% 0.0% 1.7% other A02 subtypes 0.0% 0.7% 0.8% 0.9% 0.5% 0.5% 0.0% 0.6% (A*02:12 - A*02:93)
100.0% 100.0% 100.0% 100.0% 100.0% 100.0% 100.0% 100.0%
Example 6. Generation of HPV16-E7/HLA-A*02:01 specific chimeric antigen receptor- presenting T cells (CAR-T)
[0625] Chimeric antigen receptor therapy (CAR-T therapy) is a new form of targeted immunotherapy. It merges the exquisite targeting specificity of monoclonal antibodies with the potent cytotoxicity and long-term persistence provided by cytotoxic T cells. This technology enables T cells to acquire long-term novel antigenic specificity independent of the endogenous TCR. Clinical trials have shown clinically significant antitumor activity of CAR- T therapy in neuroblastoma (Louis C.U. et ah, Blood 118(23):6050-6056), B-ALL (Maude S.L. et al., N. Engl. J. Med. 371(16): 1507-1517, 2014), CLL (Brentjens R.J. et al., Blood 118(18):4817-4828, 2011), and B cell lymphoma (Kochenderfer J.N. et al., Blood.
116(20):4099-4102, 2010). In one study, a 90% complete remission rate in 30 patients with B-ALL treated with CD19-CAR T therapy was reported (Maude S.L. et ah, supra).
[0626] To further explore the potency of the HPV16-E7/HLA-A*02:01 specific antibodies, HPV16-E7 scFv expressing CARs are constructed and transduced into T cells. For example, HPV16-E7/HLA-A*02:01 specific CARs are constructed using a lentiviral CAR expression vector. Anti-HPV16-E7/HLA-A*02:01 scFvs are grafted onto a second generation CAR (Mackall C.L. et ah, Nat. Rev. Clin. Oncol. l l(12):693-703, 2014) with CD28 signaling domain and TCRζ engineered in cis to provide intracellular T cell stimulation signals and to activate T cells. FIG. 9 provides a schematic illustration of an HPV16-E7 CAR construct.
Example 7. Characterization of HPV16-E7 CAR-T cells
In vitro Cytotoxicity study ofHPV16-E7 CAR-T cells
[0627] Lentiviruses containing HPV16-E7/HLA-A*02:01 specific chimeric antigen receptors are produced, for example, by transfection of 293T cells with CAR vectors. Human T-cells are used for transduction after 2-day stimulation with CD3/CD28 beads
(Dynabeads®, Invitrogen) in the presence of interleukin-2 at 30 U/ml. Concentrated lentiviruses are applied to T-cells in Retronectin (Takara) coated 6-well plates for 72 hours. Transduction efficiency is assessed by FACS using biotinylated HPV16-E7 tetramer and PE-
conjugated streptavidin. Repeat FACS analyses are done at 72 hours and every 3-4 days thereafter.
[0628] Functional assessment of the transduced T cells (HPV16-E7 CAR-T cells) is performed using LDH Cytotoxicity Assay. Effector-to-target ratios used include, for example, 5: 1 and 10: 1. The target cell lines may include, for example, cervical cancer cell line CaSki (ATCC CRL-1550; HLA-A2+, HPV16+), head and neck squamous cell carcinoma cell line UM-SCC-104 (Millipore; HLA-A2+, HPV16+), liver adenocarcinoma cell line SK- HEP-1 (ATCC HTB-52; HLA-A2+, HPV16"), cervical squamous cell carcinoma cell line SiHa (ATCC HTB-35; HLA-A2", HPV16+), cervical cancer cell line C33A (ATCC HTB-31; HLA-A2+, HPV16 ), cervical carcinoma cell line MS-751 (ATCC HTB-34; HLA-A2+, HPV16"), cervical adenocarcinoma cell line HeLa (ATCC CCL-2; HLA-A2", HPV16"), hepatocellular carcinoma cell line Hep3B (ATCC HB-8064; HLA-A2", HPV16"), hepatocellular carcinoma cell line HepG2 (ATCC HB-8065; HLA-A2", HPV16"), lymphoma cell line Raji (ATCC CCL-86; HLA-A2", HPV16"), T cell leukemia cell line Jurkat (ATCC TIB-152; HLA-A2", HPV16"), lymphoma cell line Daudi (ATCC CCL-213; HPA-A2", HPV16"), and leukemia cell line K562 (ATCC CCL-243; HLA-A2", HPV16"). As a control, S K-HEP- 1 -MiniG is generated by transducing SK-HEP-1 with an HPV16-E7 peptide expressing minigene cassette, which results in a high level of cell surface expression of HPV16-E7/HLA-A*02:01 complex. The specificity and efficiency of the HPV16-E7 CAR expressing T cells to kill the target-positive cancer cells is determined.
Example 8. Generation and Characterization of the full-length IgGl HPV16-E7 antibodies
[0629] Full-length human IgGl of the selected phage clones are produced, for example, in
HEK293 and Chinese hamster ovary (CHO) cell lines, as described (Tomimatsu K. et al.,
Biosci. Biotechnol. Biochem. 73(7): 1465-1469, 2009). In brief, antibody variable regions are subcloned into mammalian expression vectors, with matching human lambda or kappa light chain constant region and human IgGl constant region sequences. Applying the same cloning strategy, chimeric HPV16-E7 full-length antibodies with mouse IgGl heavy chain and light chain constant regions are generated. Molecular weight of the purified full length IgG antibodies is measured under both reducing and non-reducing conditions by electrophoresis.
SDS-PAGE of purified HPV16-E7 mouse chimeric IgGl antibodies is performed to determine protein purity. In brief, 2μg of the protein is mixed with 2.5μί of NuPAGE LDS
Sample Buffer (Life Technologies, NP0008) and brought up to ΙΟμΙ^ with deionized water. The sample is heated at 70°C for 10 minutes, and then loaded onto the gel. Gel
electrophoresis is performed at 180V for 1 hour.
[0630] HPV16-E7 chimeric IgGl antibody is tested for binding towards HPV16-E7 presenting SK-HEP-1 cells by flow cytometry. SK-HEP-1 is an HLA-A*02:01 positive and HPV16-E7 negative cell line. An HPV16-E7 minigene cassette is transfected into SK-HEP-1 cells to generate the HPV16-E7-presenting SK-HEP-l-miniG cells. 10 μg/mL of antibody is added to cells on ice for 1 hour. After washing, R-PE conjugated anti-mouse IgG(H+L) (Vector Labs#EI-2007) is added to detect antibody binding. Binding affinity of the mouse chimeric IgGl HPV16-E7 antibodies is determined by ForteBio Octet QK. 5 μg/mL biotinylated HPV16-E7 peptide/HLA-A*02:01 complex is loaded onto a streptavidin biosensor. After washing off excess antigen, mouse chimeric full-length antibodies are tested at 10 μg/mL for association and dissociation kinetics. Binding parameters are calculated using a 1: 1 binding site, partial fit model.
[0631] HPV16-E7-specific and negative control (such as ET901) mouse chimeric IgGl are tested for binding towards HPV16-E7/HLA-A*02:01, HPV16-E7 recombinant protein and free HPV16-E7 peptide in an ELISA assay. Antibodies are tested, for example, at 3x serial dilution, starting from 100 ng/mL for a total of 8 concentrations. Biotinlyated HPV16- E7/A*02:01 MHC is coated onto streptavidin plates at 2 μg/mL, HPV16-E7 protein is coated at 2 μg/mL and HPV16-E7 peptide is coated at 40 ng/mL. The ability of full-length anti- HPV16-E7/HLA-A*02:01 antibodies to recognize the HPV16-E7 peptide only in the context of HLA-A02, and not bind recombinant HPV16-E7 protein or free HPV16-E7 peptide is determined.
Example 9. In vivo efficacy studies
HPV16-E7 CAR-T cell treatment in mice
[0632] HLA-A02+/HPV16-E7+ cancer cell line (such as CaSki or UM-SCC-104) subcutaneous (s.c.) xenograft models are generated in SCID-beige (no functional T-, B-, NK- cells) mice. Animals are randomized when average s.c. tumor volume reaches 200 mm . 24 hours prior to CART administration, animals are treated (via intraperitoneal route) with 60 mg/kg cyclophosphamide. Mice are divided into 4 groups (n=8-10 mice/group) that receive one of the following: (i) no treatment (ii) 10 mock transduced CAR T cells, lx/week for 4 weeks (iii) 107 anti-E7MC CAR T cells, lx/week for 4 weeks, or (iv) 2xl06 anti-E7MC CAR
T cells, lx/week for 4 weeks. The animals in each group are monitored for tumor volume, adverse response, human cytokine profile, histopathology of tumor for human CD3+ cells in tumor and organs for CAR T cell infiltration, serum HPV16-E7, body weight and general health condition (eating, walking, daily activities).
Example 10. Affinity Maturation of anti-HPV16-E7 antibody agents
[0633] This example demonstrates the affinity maturation of anti-HPV16-E7 antibody agents. In particular, this example specifically demonstrates the generation of a series of antibody variants by incorporation of random mutations into a representative anti-HPV16-E7 antibody agent (clone US-7) followed by screening and characterization of the antibody variants.
Generation of variant phage libraries
[0634] DNA encoding anti-HPV16-E7 clone US-7 scFv was subjected to random mutagenesis using GeneMorph II Random Mutagenesis kit (Agilent Technologies) according to the manufacturer's specifications. After mutagenesis, DNA sequences were cloned into an scFv-expressing phagemid vector to build a variant human antibody phage library which contained about 5x10 unique phage clones. On average, variant clones have two nucleotide mutations compared with the parental anti-HPV16-E7 clone, ranging from 1 to 4 nucleotide mutations, per scFv sequence.
Cell panning
[0635] The human phage scFv library with mutants generated from clone US-7 was used to pan against HPV16-E7 11-19 peptide/HLA-A*02:01 complex as described in Example 2. In particular, cell panning was used. Human scFv phage library was first mixed with T2 cells loaded with 50 ug/ml of a pool of 20 different endogenous peptides (P20, SEQ ID NOs: 193- 212) as negative control panning. The negative control-depleted human scFv phage library was then mixed with T2 cells loaded with HPV16-E7 11-19 peptide (1.5 ug/ml first round, 0.8 ug/ml second round, 0.4 ug/ml third round). To load peptide, T2 cells were pulsed with peptides in serum-free RPMI1640 medium in the presence of 20 μg/ml β2Μ overnight. After extended washing with PBS, peptide-loaded T2 cells with bound scFv antibody phage were spun down. The bound clones were then eluted and used to infect E.coli XLl-Blue cells. The phage clones expressed in bacteria were then purified. The panning was performed for 3 rounds to enrich for scFv phage clones that bound HPV16-E7 11-19 peptide/HLA-A*02:01 specifically.
[0636] Streptavidin ELISA plates were coated with biotinylated HPV 16-E7 11-19 peptide/HLA-A*02:01 complex monomer or biotinylated P20 control peptides/HLA- A*02:01 monomer. Individual phage clones from enriched phage display panning pools against HPV16-E7 11-19 peptide/HLA-A*02:01 complex were incubated in the coated plates. Binding of the phage clones was detected by HRP-conjugated anti-M13 antibodies and developed using HRP substrate. The absorbance was read at 450nm. 15 positive clones were identified through ELISA screening of 135 phage clones enriched from phage panning. 11 unique clones were identified by DNA sequencing of the 15 ELISA-positive phage clones. Specific and unique clones were further tested for their binding to HLA-A*02:01/peptide complexes on live cell surface by flow cytometry (FACS analysis) using HPV16-E7 11-19 peptide-loaded live T2 cells. Controls included T2 cells without peptide loading (cells only) and R-PE conjugated horse anti-mouse IgG control (secondary antibody only). Briefly, T2 cells loaded with HPV16-E7 11-19 peptide or P20 peptide pool were first stained with purified scFv phage clones, followed by a second staining with mouse anti-M13 mAb, and a third staining with R-PE conjugated horse anti-mouse IgG from Vector Labs. Each staining step was performed for 30-60 minutes on ice and the cells were washed twice between staining steps. Among the 10 unique clones tested, 8 recognized HPV16-E7 11-19-loaded T2 cells specifically (SEQ ID NOs: 223-230). These 8 phage clones specifically bound to HPV16-E7 11-19-loaded T2 cells and did not recognize T2 cells loaded with P20 peptide pool in the context of HLA-A*02:01, or T2 cells without peptide loaded.
Example 11. Characterization of bi-specific antibody molecules based on anti-HPV16- E7 affinity maturation variants
Generation of bispecific antibodies
[0637] Bispecific antibodies (BsAbs) were generated using scFv sequences of the affinity matured HPV16-E7/HLA-A*02:01-specific phage clones isolated in Example 10 (SEQ ID NOs: 223-232) using the method described in Example 4. The resulting single-chain bispecific antibodies comprised the scFv sequence of an HPV16-E7/HLA-A*02:01-specific phage clone at the N-terminal end and an anti-human CD3s mouse monoclonal scFv at the C- terminal end.
Determination of binding affinities of bispecific antibodies to HPV16-E7/HLA-A*02:01
[0638] The binding affinity of 7 HPV16-E7 BsAb antibodies (derived from affinity matured clones 7-1, 7-3, 7-6, 7-7, 7-8, and 7-9, corresponding to SEQ ID NOs: 223, 225, and
227-230, respectively, and parental clone US-7) to recombinant HPV16-E7/HLA-A*02:01
complex was measured by Surface Plasma Resonance (BiaCore). The binding parameters between the HPV16-E7 BsAbs and HPV16-E7/HLA-A*02:01 complex were measured using a Biotin CAPture Kit (GE Healthcare, Cat# 28920233) on a Biacore X100 (GE Healthcare) according to the manufacturer's protocol for multi-cycle kinetics measurement. All of the proteins used in the assay were diluted using HBS-EP running buffer. 5 μg/mL of biotinylated HPV16-E7 1 l-19/HLA-A*02:01/p2M complex was immobilized onto a Sensor Chip CAP pre-functionalized with streptavidin (-3,800 RU of streptavidin captured) by flowing the solution through the flow cell at 5 μΕ/min for 75 seconds (-120 RU of MHC complex was captured per cycle). Binding towards the HPV16-E7 BsAbs was analyzed at 150 nM, 75 nM, 37.5 nM, 18.8 nM, and 9.4 nM, each run consisting of a 2 minute association and 10 minute dissociation at 30 μΕ/min. At the end of cycle, the surface was regenerated using the regeneration buffer from the Biotin CAPture kit. The data was analyzed using 1: 1 binding site mode with the BiaCore X-100 evaluation software. The binding parameters (association on rate constant ka, dissociation constant kd, and equilibrium dissociation constant Kd) were then calculated, and are shown in Table 9. BsAbs derived from clones 7-1, 7-3, 7-6, 7-7, and 7-9 showed increased binding affinity compared to the BsAb derived from parental clone US-7, while the BsAb derived from clone 7-8 showed decreased binding affinity.
Table 9
Cross-reactivity and binding affinities of HPV16-E7 bispecific antibodies against multiple HLA-A02 alleles
[0639] As described above in Example 5, the different subtypes of the HLA-A02 group are quite conserved, and cross-reactivity against multiple HLA-A02 subtypes is highly desired.
Therefore, experiments were performed to determine whether the bi- specific antibodies
(BsAb) generated from the parental clone US-7 and the affinity maturation variants cross-
react with non-HLA-A*02:01 subtypes of the HLA-A02 group. Specifically, HPV16-E7 11- 19/MHC class I complexes with various subtypes of the HLA-A02 allele were generated, and their binding affinities to the HPV16-E7 l l-19/HLA-A*02:01-specific antibodies were determined using the Octet® QKe System by Pall ForteBio LLC (Menlo Park, CA), which utilizes the Biolayer Interferometry (BLI) technology. The BsAbs tested include the parental clone US-7 and affinity maturation variant clones 7-1, 7-3, 7-6, 7-7, 7-8, and 7-9. Five μg/mL biotinylated HPV16-E7 11-19 peptide/HLA-A02 complex having varying subtypes of HLA- A02 was loaded onto a streptavidin biosensor. After washing off excess antigen (the HPV16- E7 peptide/HLA-A02 complex), BsAbs were tested at 10 μg/mL for association and dissociation kinetics. Binding parameters were calculated using a 1: 1 binding site, partial fit model. The results of the BLI assay are shown below in Table 10.
Table 10. HLA-A02 subtype binding parameters
Binding Affinity (KD[nM])
BsAb
A0201 A0202 A0203 A0205 A0206 A0207 A0211
Clone #US-7 51.5 - 92.1 25.4 80.4
Clone #7-1 45.3 13.5 43 14.9 39.3
Clone #7-3 42.4 14.4 41.4 14.6 37
Clone #7-6 58.5 12 47.6 10.7 43.1
Clone #7-7 32.8 14.8 53.2 17.7 63.4
Clone #7-8 99.7 - 62.1 22 90.7
Clone #7-9 21.7 15.3 38.6 10.6 38.2
-" indicates no detectable specific binding
[0640] The results show that each of the tested antibody clones specifically bound to at least four out of the seven HLA-A02 subtypes tested. Several affinity maturation variant antibodies bound to more HLA-A02 subtypes than the parental clone did, and many of the affinity maturation variant antibodies bound to HPV16-E7 11-19/HLA-A02 with higher affinities than the parental clone did, indicated by lower KD values.
Peptide binding specificity assay
[0641] In order to confirm the specificity of the peptide recognized by the affinity maturation variant antibodies, a FACS analysis was performed with T2 cells loaded with
HPV16-E7 11-19 peptide, the P20 peptide pool, or no peptide. The result showed that all the BsAbs tested, including the parental clone US-7 and affinity maturation variant clones 7-1, 7- 3, 7-6, 7-7, 7-8, and 7-9, specifically bound to T2 cells loaded with HPV16-E7 11-19 peptide, but did not bind to T2 cells loaded with the P20 peptide pool or not loaded with any peptide. The FACS data is shown herein in Table 12.
Epitope mapping by alanine walking
[0642] To investigate with precision the sensitive residues of the HPV16-E7 11-19 peptide for recognition by BsAbs Clone # US-7 and its affinity maturation variants, a series of mutant peptides were designed and synthesized to have each of the nine residues substituted with alanine (shown in Table 11).
Table 11. HPV16-E7 11-19 wild-type and mutant peptides
[0643] BsAb clones were then tested by FACS analysis for binding to T2 cells loaded with the peptides from Table 11, T2 cells loaded with the negative control P20 peptide pool, or T2 cells with no peptide loaded. Peptide binding to MHC on the T2 cells was assessed by BB7.2 mouse antibody staining. All peptides except for HPV16-E7 l l-19mut8 showed greater BB7.2 antibody binding compared to control T2 eels without peptide (data not shown), indicated that all peptides except for HPV16-E7 11-I9mut8 were successfully able to bind MHC on the T2 cells. For BsAb analysis, cells were stained with 10 μg/mL BsAb followed by 20X dilution of APC anti-His antibody (R&D System #IC050A). FACS mean fluorescent intensity (MFI) values of each FACS assay are shown in Table 12. The parental US-7 and affinity matured scFvs are predicted to bind to the C-terminal half of the HPV16-E7 peptide
since alanine substitution at positions 5-8 generally reduced binding to the peptide-loaded T2 cells. The individual FACS binding assay results are shown in FIGS. 10A and 10B.
Table 12. Alanine walking of HPV16-E7 11-19 (FACS, mean fluorescent intensity)
BsAb Sample Clone # Clone # Clone # Clone # Clone # Clone # Clone #
US-7 7-1 7-3 7-6 7-7 7-8 7-9
T2 with no peptide 157 186 154 165 184 163 201
P20 160 180 156 163 195 164 247
HPV16-E7 11-19 {wild- 24000 27000 25700 24100 20800 22400 17600 type;
HPV16-E7 ll-19mutl 20700 23100 19700 21000 18900 19100 15500
HPV16-E7 ll-19mut2 19100 24000 20300 22300 17600 19100 15900
HPV16-E7 ll-19mut3 18100 24100 20300 20600 18200 17700 16100
HPV16-E7 ll-19mut4 716Q0 ::;:¾;:;s 7 is5WQ0 717Q0 221 no 19300 20900 168Q0
HPV16-E7 ll-19mut5 6274 13400 11900 11300 8452 8242 9660
HPV16-E7 ll-19mut6 9221 16800 15700 13600 19300 4864 11500
HPV16-E7 ll-19-mut7 7575 14000 13900 11600 9650 9199 10100
HPV16-E7 ll-19-mut8 237 733 703 211 740 293 1135
HPV16-E7 ll-19-mut9 19200 20900 19900 22900 18500 19700 16100
Sensitive Position* 5,6,7,8 5,8 5,8 ZZZ Z ZZZ Z 5,6,7,8 5,8
Reduced binding 6,7 6.7 6.7 position**
*: Sensitive position: < 50% MFI (T2 loaded with wild-type HPV16-E7 11- 19)
**: Reduced binding: 50-75% MFI (T2 loaded with wild-type HPV16-E7 11- 19)
Example 12. Generation of chimeric antigen receptor-presenting T cells (CAR-T) with anti-HPV16-E7 affinity maturation scFvs variants
[0644] Chimeric antigen receptors expressing affinity matured HPV16-E7 scFvs were constructed and transduced into T cells. CAR vectors for production of lentivirus encoding the HPV16-E7/HLA-A*02:01 specific CARs were constructed by fusing an affinity matured scFv isolated in Example 10 (7- 1, 7-3, 7-6, 7-7, 7-8, and 7-9, corresponding to SEQ ID NOs: 223, 225, and 227-230, respectively) or the parental US-7 scFv with either a polypeptide having CD28 and CD3ζ signaling domains (SEQ ID NO: 256) or a polypeptide having 4- 1BB and ΟΌ3ζ signaling domains (SEQ ID NO: 257).
[0645] Lentiviruses containing the HPV16-E7/HLA-A*02:01 specific chimeric antigen receptors were produced by transfection of 293T cells with the CAR vectors. Human T-cells were used for transduction after 1-day stimulation with CD3/CD28 beads (Dynabeads®,
Invitrogen) in the presence of interleukin-2 at 100 U/ml. Concentrated lentiviruses were applied to T-cells in Retronectin (Takara) coated 6-well plates for 72 hours. Five days after transduction, HPV16-E7 CAR-T cells and mock-transduced cells were co- stained with biotinylated HPV16-E7 11-19 peptide/HLA-A*02:01 tetramers and CD4 or CD8 antibodies and analyzed by flow cytometry. FIGS. 11A-11C show flow cytometry results for HPV16-E7 CAR-T cells and mock-transduced cells. Results are summarized in Table 13. Each of the tested CARs with an affinity matured scFv had higher transduction efficiency than the CAR with the parental scFv.
Table 13
Example 13. T-cell killing assay using CAR-T with anti-HPV16-E7 affinity maturation variants with cancer cell lines
In vitro Cytotoxicity study ofHPV16-E7 CAR-T cells
[0646] Tumor cytotoxicity of T cells expressing a CAR having an affinity matured scFv (7- 1, 7-3, 7-6, 7-7, 7-8, and 7-9, corresponding to SEQ ID NOs: 223, 225, and 227-230, respectively) or the parental US-7 scFv was assayed by LDH Cytotoxicity Assay (Promega).
Human T cells purchased from AllCells were activated, then transduced with the CAR and expanded with CD3/CD28 Dynabeads (Invitrogen) according to manufacturer's protocol. Activated CAR-T cells were cultured and maintained in RPMI1640 medium with 10% FBS plus 100 U/ml IL-2, and used at day 7-14. Activated CAR-T cells (effector cells) and target cancer cells were co-cultured at a 5: 1 ratio for 16 hours. Cytotoxicities were then determined by measuring LDH activities in culture supernatants.
[0647] Target cancer cells tested included cervical cancer cell line CaSki (ATCC CRL- 1550; HLA-A2+, HPV16+), cervical carcinoma cell line MS-751 (ATCC HTB-34; HLA-A2+, HPV16"), and mantle cell lymphoma cell line JeKo-1 (ATCC CRL-3006; HLA-A2+, HPV16" ). As shown in FIG. 12, the affinity matured clones (7-1, 7-3, 7-6, 7-7, 7-8, and 7-9) demonstrated significantly increased killing activity in both CD28/CD3ζ and 4-1ΒΒΛ ϋ3ζ formats compared to the parental clone US -7.
[0648] Additional target cancer cells that may be tested include head and neck squamous cell carcinoma cell line UM-SCC-104 (Millipore; HLA-A2+, HPV16+), liver adenocarcinoma cell line SK-HEP-1 (ATCC HTB-52; HLA-A2+, HPV16"), cervical squamous cell carcinoma cell line SiHa (ATCC HTB-35; HLA-A2", HPV16+), cervical cancer cell line C33A (ATCC HTB-31; HLA-A2+, HPV16 ), cervical adenocarcinoma cell line HeLa (ATCC CCL-2; HLA- A2~, HPV16"), hepatocellular carcinoma cell line Hep3B (ATCC HB-8064; HLA-A2", HPV16 ), hepatocellular carcinoma cell line HepG2 (ATCC HB-8065; HLA-A2", HPV16"), lymphoma cell line Raji (ATCC CCL-86; HLA-A2", HPV16"), T cell leukemia cell line Jurkat (ATCC TIB-152; HLA-A2", HPV16"), lymphoma cell line Daudi (ATCC CCL-213; HPA-A2", HPV16"), and leukemia cell line K562 (ATCC CCL-243; HLA-A2", HPV16").
Sequence Listing
SEP ID NO: 1, HPV16 E7 protein
MHGDTPTLHEYMLDLQPETTDLYCYEQLNDSSEEEDEIDGPAGQAEPDRAHYNIVTF CCKCDSTLRLCVQSTHVDIRTLEDLLMGTLGIVCPICSQKP
SEP ID NO: 2, HPV16 E7 CDS
ATGCATGGAGATACACCTACATTGCATGAATATATGTTAGATTTGCAACCAGAGA
CAACTGATCTCTACTGTTATGAGCAATTAAATGACAGCTCAGAGGAGGAGGATG
AAATAGATGGTCCAGCTGGACAAGCAGAACCGGACAGAGCCCATTACAATATTG
TAACCTTTTGTTGCAAGTGTGACTCTACGCTTCGGTTGTGCGTACAAAGCACACA
CGTAGACATTCGTACTTTGGAAGACCTGTTAATGGGCACACTAGGAATTGTGTGC
CCCATCTGTTCTCAGAAACCATAA
SEP ID NP: 3, HPV16 E7 7-15
TLHEYMLDL
SEP ID NP: 4, HPV16 E7 11-19
YMLDLQPET
SEP ID NP: 5, HPV16 E7 16-25
QPETTDLYCY
SEP ID NP: 6, HPV16-E7 44-52
QAEPDRAHY
SEP ID NP: 7, HPV16-E7 46-55
EPDRAHYNIV
SEP ID NP: 8, HPV16-E7 49-57
RAHYNIVTF
SEP ID NP: 9, HPV16 E7 82-90
LLMGTLGIV
SEP ID NP: 10, HPV16 E7 86-93
TLGIVCPI
SEP ID NP: 11, HPV16 E7 11-19 variant
YMLDVQPET
SEP ID NP: 12, HPV16 E7 11-19 Al
AMLDLQPET
SEP ID NP: 13, HPV16 E7 11-19 A5
YMLDAQPET
SEP ID NP: 14, HPV16 E7 11-19 A8
YMLDLQPAT
SEP ID NO: 15, HCVR 1
QVQLVQSGAEVKKPGASVKVSCKASGYTFIDYYIHWVRQAPGQGLEWMGWINPKS
GGTKYAQKFQGRVTMTRDTSITTAYMELSSLTSDDTAVYYCARSYYYGGVKDYWG
QGTLVTVSS
SEP ID NO: 16, HCVR 2
QVQLVQSGAEVKKPGSSVKVSCKASGGTFSSYAISWVRQAPGQGLEWMGGIIPIFGT
ANYAQKFQGRVTITADESTSTAYMELSSLRSEDTAVYYCARGVYGYSGSAPYDEWG
QGTLVTVSS
SEP ID NP: 17, HCVR 3
E VQLVQS G AE VKKPGS S VKVS C KAS GGTFS M A AIS W VRQ APGQGLEWMGRIIPMIGI PDYAQEFQGRVTFTADRSTSTAYMELSSLRSDDTAVYYCARGPLYWWHSDSWGQG TLVTVSS
SEP ID NP: 18, HCVR 4
Q VQLVQS GGG V VQPGRS LRLS C A AS GFTFS S Y AIHW VRQ APGKGLEW V A VIS YDGT
NKYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARMHGSYGSYFDKWG
QGTLVTVSS
SEP ID NP: 19, HCVR 5
QVQLVQSGAEVKKPGSSVKVSCKASGGTFRSYAVSWVRQAPGQGLEWMGRIIPIFG TPD Y AQKFQGR VTIT AD AS TS T AHMELS GLRS EDT A V Y YC ARS S M YQ YS HDD WGQ GTLVTVSS
SEP ID NP: 20, HCVR 8
EVQLVQSGAEVKKPGASVKVSCKASGYTFANYGINWVRQAPGQGLEWMGWISASN GNTN Y AQKLQGR VTMTTDTS TS T A YMELRS LRS DDT A V Y YC ARS Y Y AG Y YMFMD FWGQGTLVTVSS
SEP ID NP: 21, HCVR 9
EVQLVESGGGLVQPGGSLRLSCAASGFTFSSYWMSWVRQAPGKGLEWVANINQDG SEKYYVDSVKGRFTISRDNAKNSLYLQMNSLRAEDTAVYYCARYSVWGMMDEWG QGTLVTVSS
SEP ID NP: 22, HCVR 10
Q VQLVQS GGG V VQPGRS QRLS C A AS GFPFS SYS MNW VRRAPGKGLEW VS YIS S S S S T IYYADSVKGRFTISRDNAKNSLYLQMNSLRAEDTAVYYCARQNYYADYDYWGQGT LVTVSS
SEP ID NP: 23, HCVR 11
QVQLVQSGAEVKKPGASVKVSCKTSGYTFSDYGISWVRQAPGQGLEWLGWISTYN GNTDLAQKVRGR VTLTTDTSTSTA YMELRS LRSEDT A VYYCARGYTGSYYATGDE WGQGTLVT VS S
SEP ID NP: 24, HCVR 13
QVQLVQSGAEVKKPGASVKVSCKASGYTFTSYGISWVRQAPGQGLEWMGWISPYN GNTNYAQKLQGRVTMTTDTSTSTAYMELRSLRSDDTAVYYCARGYKDYWGQGTL VTVSS
SEP ID NO: 25, HCVR 17
QVQLVQSGAEVRKPGSSVKVSCKASGDIFRKFAVSWVRQAPGQGPEWMGRIIPNLDI TDKPQKFQGRVTLS ADKSTSTVYLELS S LRSEDTA VYYC ARGS IYQWS GWDS WGQG TLVTVSS
SEP ID NO: 26, HCVR 22
E VQLVES GGGLVKPGGS LRLS C A AS GFNFS D Y YMTWIRQ APGKGLEWLS YIS PGGTT Y Y A AS VEGRFTIS RDN AKNS LYLQMNS LR AEDT A V Y YC ARGHS FS YGED YWGQGT LVTVSS
SEP ID NP: 27, HCVR 26
QVQLVQSGAEVKKPGASVKVSCKASGYTFTGYYMHWVRQAPGQGLEWMGWINPN S GGTN Y AQKFQGR VTMTRDTS IS T A YMELS RLRS DDT A V Y YC ARGWHQ YGIMD YW GQGTLVTVSS
SEP ID NP: 28, HCVR 27
EVQLVESGGGLVQPGGSLRLSCAASGFTFSSYAMSWVRQAPGKGLEWVSAISGSGG S T Y Y ADS VKGRFTIS RDNS KNTLYLQMNS LR AEDT A V Y YC ARRS VWS A YDS WGQG TLVTVSS
SEP ID NP: 29, HCVR 31
QVQLVQSGGGLVQPGGSLRLSCAASGFTFSSYWMSWVRQAPGKGLEWVGNIKEDG
SVKYYVDSVKGRFTISRDNAKNSVYLEMNNLRAEDTAVYYCARRGVWGHIDFWGQ
GTLVTVSS
SEP ID NP: 30, HCVR 32
E VQLVQS G AE VKKPGS S VKVS C KAS GGTFS S Y AIS W VRQ APGQGLE WMGRIIPILGI ANYAQKFQGRVTITADKSTSTAYMELSSLRSEDTAVYYCARGTYTWGSDTWGQGT LVTVSS
SEP ID NP: 31, HCVR 39
Q VQLVES GGGLVQPGGS LRLS C A AS GFS FS RH AMNW VRQ APGKGLE W VS AIS GS GG
NTYYSDSVEGRFTMSRDNSKNTLYLQMNSLRAEDTAVYYCARYWGSYDKWGQGT
LVTVSS
SEP ID NP: 32, HCVR 40
E VQLVQS G AE VKKPG AS VKVS CT AS G YS FS D Y YIYWLRQGPGQGLEWMGWINPNT GVTHYAQKYQGRVTMTRDTSINTVYMELSRLRSDDTAVYYCARNVYRYSMMHDS WGQGTLVT VS S
SEP ID NP: 33, HCVR 41
Q AQLVQS GGGLVKPGGS LRLS C A AS GFTFS SYS MNW VRQ APGKGLE WVS S IS S S S S Y
IYYADSVRGRFTISRDNAKNSLFLQMNSLRAEDTAVYYCARRGVWGYFDSWGQGT
LVTVSS
SEP ID NO: 34, HCVR US-5
E VQLVQS G AE VKKPGS S VKVS C KAS GGTFS S YGIS W VRQ APGQGLE WMGGIIPIFGT
TNYAQKFQGRVTITADESTRTAYMELSSLRSEDTAVYYCARVYGSYFYDDWGQGTL
VTVSS
SEP ID NO: 35, HCVR US-7
QVQLQQWGAGLLKPSETLSLTCAVYGGSFSGYYWSWIRQPPGKGLEWIGEINHSGST NYNPSLKSRVTISVDTSKNQFSLKLSSVTAADTAVYYCARAPQSWYVGDVWGQGTL VTVSS
SEP ID NP: 36, LCVR 1
Q A VLTQPPS AS GTPGQR VTIS C S GS S S NIGTNP VTW YQHLPGT APKLLIYGNYQRPS G VPDRFS GS KS GTS AS LAIS GLQSEDE AD YYC AAWDDS LTGYVFGTGTKVTVLG
SEP ID NP: 37, LCVR 2
QS VLTQPPS LS V APGKT AS ITC GGNNIGMKS VHW YQQRPGQ AP VLVIY YDS DRPS GIP GRFSGSNSGNTATLTISRVEAGDEADYYCQVWDTTGDHPGYVFGTGTKVTVLG
SEP ID NP: 38, LCVR 3
QS V VTQPPS VS A APGQKVTIS C S GS S S NIGNN Y VS W YQHFPG A APKLLIYDN YKRPS G IPDRFSGSKSGTSATLGITGLQTGDEAEYYCGTWDSSLSAYVFGTGTKVTVLG
SEP ID NP: 39, LCVR 4
S YELTQPPS VS V APGKT ARITCGGNNIGS KS VHW YQQKPGQAP VLVIY YNS DRPS GIP ERFSGSNSGNTATLTISRVEAGDEADYYCQVWDSSSDHWVFGGGTKLTVLG
SEP ID NP: 40, LCVR 5
DIQMTQS PS S VS AS VGDR VTITCRAS QGIS S WLA W YQQKPGKAPKLLIY A AS S LQS G VPSRFS GS GS GTDFTLTIS S LQPEDFAT YYCQQANSFPLTFGGGTKVEIKR
SEP ID NP: 41, LCVR 8
QS VLTQPPS AS GTPGQR VTIS C S GHNS NIETNP VS W YQQ VPGTTPKLLIYS Y Y YRPS G VPDRFS GS KS GTS AS LAIS GLQSEDE AD YFC AS WDDSVQGYVFGS GTKVTVLG
SEP ID NP: 42, LCVR 9
SSELTQDPAVSVALGQTVRITCQGDSLRSYYASWYQQKPGQAPVLVIYGKNNRPSGI PDRFS GS S S GNTASLTITGAQAEDEAD Y YCNSRDS S GNHQVFGTGTKVTVLG
SEP ID NP: 43, LCVR 10
QS VLTQPPS VS V APGKT ARITC GGNNIGS KN VHW YQQKPGQAP VLVVYDDHDGPS G IPERFSGSNSGNTATLTISRVEAGDEADYYCQVWDSSSDHVVFGGGTKLTVLG
SEP ID NP: 44, LCVR 11
Q A VLTQPPS AS GTPGQR VTIS C S GS S S NIGINT VNW YQQLPGT APKLLIYGNS HRPS G VPDRFS GS KS GAS AS LAITGLQ ADDEG A YFC QS YDTS LT VIFGGGTKLT VLG
SEP ID NP: 45, LCVR 13
QTVVTQEPSLTVSPGGTVTLTCASSTGAVTSGYYPNWFQQKPGQAPRALIYSTNNKH SWTPARFSGSLLGGKAALTLSGVQPEDEAEYYCLLYYGGAQLWVFGGGTKLTVLG
SEP ID NO: 46, LCVR 17
DIQMTQS PS S LS AS VGDR VTITCRAS QS IS S YLNW YQQKPGQ APNLLIYG AS S FQS G V PSRFSGSGS GTDFTLTIS S LQPEDFAT Y YC QQS YS APLTFGGGTKVDIKR
SEP ID NO: 47, LCVR 22
Q A VLTQPPS AS GTPGQR VTIS C S GS S S NIGS NS VNW YQQ VPGT APKLLIYS NNQRPS G VPDRFS GS KS GTS AS LAITKLQSEDEAD YYC AAWDDS LNG YVFGTGTKVT VLG
SEP ID NP: 48, LCVR 26
QS VLTQPPS VS G APGQR VTIS CTGS S S NIG AG YD VHW YQQLPGT APKLLIYES NNRPS GVPDRFSGSKSGTSASLAITGLQAEDEADYYCQSYDTSLKGVFGPGTKVTVLG
SEP ID NP: 49, LCVR 27
SSELTQDPAVSVALGQTVTITCQGDILRNYYATWYQQKPGQAPSLVLYGQNNRPSGI PDRFSGSTSGNTASLTITGAQAEDEGDYYCDSRDSSGNHWVFGGGTKLTVLG
SEP ID NP: 50, LCVR 31
SSELTQDPALSVALGQTVTITCRGDNLRNSYASWYQQKPGQAPVVVLYGKNRRPSGI PDRFS GS S S GNTASLTITGAQADDE AD YYCNSRDS S GFPPYVFGPGTKVT VLG
SEP ID NP: 51, LCVR 32
S Y VLTQPPS VSVSPGQTAS ITC S GDKLGEKY V YW YQQRPGQS P VLVIFQNDKRPS GIP ERLS GSRS GNT ATLTIS GTQAMDE AD YYCQS WAS S S VYVFGTGTKLTVLG
SEP ID NP: 52, LCVR 39
SSELTQDPAVSVALGQTVRITCQGDSLRNYYASWYQQKPGQAPVLVLYGKDNRPSG IPDRFS GS S S GNTAS LTITGAQAEDEAD YYCNSRDS S GNHRVFGGGTKLT VLG
SEP ID NP: 53, LCVR 40
Q A VLTQPPS AS GTPGQR VTIS C S GS S S NIGS NH VNW YQQLPGT APKLLIS NNNQRPS G VPDRFS GS KS GTS AS LAIS GLQSEDE AD YYC AAWDDS LNVPVFGGGTQLTVLS
SEP ID NP: 54, LCVR 41
SSELTQDPAVSVALGQTVRITCQGDTLRSFYASWYQQKPGQAPVLVFYGKNNRPSGI PERFSGSNSENTASLTIAGAQAEDEADYYCNSRDSGGDPVVFGGGTKLTVLG
SEP ID NP: 55, LCVR US-5
Q A V VTQEPS LT VS PGGT VTLTC AS S TG A VTS S Y YPNWFQQKPGQ APRALIYS TS NTH SWTPARFSGSLLGGKAALTVSGVQPEDEAEYYCLLYYGGARVFGGGTKLTVLG
SEP ID NP: 56, LCVR US-7
S YELTQPPS VS GTPGQR VAIS CS GS S S NIGTRM VT W YQH VPGT APKLLIFNNNQRPS G VPDRFSASKSGTSASLAIIGLQSDDEADYYCAAWDDNLKSYVFGTGTKVTVLG
SEP ID NP: 57, HC-CDR1 1
GYTFIDYY
SEP ID NP: 58, HC-CDR1 2
GGTFSSYA
SEP ID NO: 59, HC-CDRl 3
GGTFSMAA
SEP ID NO: 60, HC-CDRl 4
GFTFSSYA
SEP ID NP: 61, HC-CDRl 5
GGTFRSYA
SEP ID NP: 62, HC-CDRl 8
GYTFANYG
SEP ID NP: 63, HC-CDRl 9
GFTFSSYW
SEP ID NP: 64, HC-CDRl 10
GFPFSSYS
SEP ID NP: 65, HC-CDRl 11
GYTFSDYG
SEP ID NP: 66, HC-CDRl 13
GYTFTSYG
SEP ID NP: 67, HC-CDRl 17
GDIFRKFA
SEP ID NP: 68, HC-CDRl 22
GFNFSDYY
SEP ID NP: 69, HC-CDRl 26
GYTFTGYY
SEP ID NP: 70, HC-CDRl 27
GFTFSSYA
SEP ID NP: 71, HC-CDRl 31
GFTFSSYW
SEP ID NP: 72, HC-CDRl 32
GGTFSSYA
SEP ID NP: 73, HC-CDRl 39
GFSFSRHA
SEP ID NP: 74, HC-CDRl 40
GYSFSDYY
SEP ID NO: 75, HC-CDRl 41
GFTFSSYS
SEP ID NP: 76, HC-CDRl US-5
GGTFSSYG
SEP ID NP: 77, HC-CDRl US-7
GGSFSGYY
SEP ID NP: 78, HC-CDR2 1
INPKSGGT
SEP ID NP: 79, HC-CDR2 2
IIPIFGTA
SEP ID NP: 80, HC-CDR2 3
IIPMIGIP
SEP ID NP: 81, HC-CDR2 4
ISYDGTNK
SEP ID NP: 82, HC-CDR2 5
IIPIFGTP
SEP ID NP: 83, HC-CDR2 8
ISASNGNT
SEP ID NP: 84, HC-CDR2 9
INQDGSEK
SEP ID NP: 85, HC-CDR2 10
ISSSSSTI
SEP ID NP: 86, HC-CDR2 11
ISTYNGNT
SEP ID NP: 87, HC-CDR2 13
ISPYNGNT
SEP ID NP: 88, HC-CDR2 17
IIPNLDIT
SEP ID NP: 89, HC-CDR2 22
ISPGGTT
SEP ID NP: 90, HC-CDR2 26
INPNSGGT
SEP ID NO: 91, HC-CDR2 27
ISGSGGST
SEP ID NO: 92, HC-CDR2 31
IKEDGSVK
SEP ID NP: 93, HC-CDR2 32
IIPILGIA
SEP ID NP: 94, HC-CDR2 39
ISGSGGNT
SEP ID NP: 95, HC-CDR2 40
INPNTGVT
SEP ID NP: 96, HC-CDR2 41
ISSSSSYI
SEP ID NP: 97, HC-CDR2 US-5
IIPIFGTT
SEP ID NP: 98, HC-CDR2 US-7
INHSGST
SEP ID NP: 99, HC-CDR3 1
ARSYYYGGVKDY
SEP ID NP: 100, HC-CDR3 2
ARGVYGYSGSAPYDE
SEP ID NP: 101, HC-CDR3 3
ARGPLYWWHSDS
SEP ID NP: 102, HC-CDR3 4
ARMHGSYGSYFDK
SEP ID NP: 103, HC-CDR3 5
ARSSMYQYSHDD
SEP ID NP: 104, HC-CDR3 8
ARS Y Y AG Y YMFMDF
SEP ID NP: 105, HC-CDR3 9
ARYSVWGMMDE
SEP ID NP: 106, HC-CDR3 10
ARQNYYADYDY
SEP ID NP: 107, HC-CDR3 11
ARGYTGSYYATGDE
SEP ID NO: 108, HC-CDR3 13
ARGYKDY
SEP ID NO: 109, HC-CDR3 17
ARGSIYQWSGWDS
SEP ID NP: 110, HC-CDR3 22
ARGHSFSYGEDY
SEP ID NP: 111, HC-CDR3 26
ARGWHQYGIMDY
SEP ID NP: 112, HC-CDR3 27
ARRSVWSAYDS
SEP ID NP: 113, HC-CDR3 31
ARRGVWGHIDF
SEP ID NP: 114, HC-CDR3 32
ARGTYTWGSDT
SEP ID NP: 115, HC-CDR3 39
ARYWGSYDK
SEP ID NP: 116, HC-CDR3 40
ARNVYRYSMMHDS
SEP ID NP: 117, HC-CDR3 41
ARRGVWGYFDS
SEP ID NP: 118, HC-CDR3 US-5
ARVYGSYFYDD
SEP ID NP: 119, HC-CDR3 US-7
ARAPQSWYVGDV
SEP ID NP: 120, LC-CDR1 1
SSNIGTNP
SEP ID NP: 121, LC-CDR1 2
NIGMKS
SEP ID NP: 122, LC-CDR1 3
SSNIGNNY
SEP ID NP: 123, LC-CDR1 4
NIGSKS
SEP ID NO: 124, LC-CDRl 5
QGISSW
SEP ID NO: 125, LC-CDRl 8
NSNIETNP
SEP ID NP: 126, LC-CDRl 9
SLRSYY
SEP ID NP: 127, LC-CDRl 10
NIGSKN
SEP ID NP: 128, LC-CDRl 11
SSNIGINT
SEP ID NP: 129, LC-CDRl 13
TGAVTSGYY
SEP ID NP: 130, LC-CDRl 17
QSISSY
SEP ID NP: 131, LC-CDRl 22
SSNIGSNS
SEP ID NP: 132, LC-CDRl 26
SS NIG AG YD
SEP ID NP: 133, LC-CDRl 27
ILRNYY
SEP ID NP: 134, LC-CDRl 31
NLRNSY
SEP ID NP: 135, LC-CDRl 32
KLGEKY
SEP ID NP: 136, LC-CDRl 39
SLRNYY
SEP ID NP: 137, LC-CDRl 40
SSNIGSNH
SEP ID NP: 138, LC-CDRl 41
TLRSFY
SEP ID NP: 139, LC-CDRl US-5
TGAVTSSYY
SEP ID NO: 140, LC-CDRl US-7
SSNIGTRM
SEP ID NO: 141. LC-CDR2 1
GNY
SEP ID NP: 142. LC-CDR2 2
YDS
SEP ID NP: 143. LC-CDR2 3
DNY
SEP ID NP: 144. LC-CDR2 4
YNS
SEP ID NP: 145. LC-CDR2 5
AAS
SEP ID NP: 146. LC-CDR2 8
SYY
SEP ID NP: 147. LC-CDR2 9
GKN
SEP ID NP: 148. LC-CDR2 10
DDH
SEP ID NP: 149. LC-CDR2 11
GNS
SEP ID NP: 150. LC-CDR2 13
STN
SEP ID NP: 151. LC-CDR2 17
GAS
SEP ID NP: 152. LC-CDR2 22
SNN
SEP ID NP: 153. LC-CDR2 26
ESN
SEP ID NP: 154. LC-CDR2 27
GQN
SEP ID NP: 155. LC-CDR2 31
GKN
SEP ID NP: 156. LC-CDR2 32
QND
SEP ID NO: 157, LC-CDR2 39
GKD
SEP ID NO: 158, LC-CDR2 40
NNN
SEP ID NP: 159, LC-CDR2 41
GKN
SEP ID NP: 160, LC-CDR2 US-5
STS
SEP ID NP: 161, LC-CDR2 US-7
NNN
SEP ID NP: 162, LC-CDR3 1
AAWDDSLTGYV
SEP ID NP: 163, LC-CDR3 2
QVWDTTGDHPGYV
SEP ID NP: 164, LC-CDR3 3
GTWDSSLSAYV
SEP ID NP: 165, LC-CDR3 4
QVWDSSSDHWV
SEP ID NP: 166, LC-CDR3 5
QQANSFPLT
SEP ID NP: 167, LC-CDR3 8
ASWDDSVQGYV
SEP ID NP: 168, LC-CDR3 9
NSRDSSGNHQV
SEP ID NP: 169, LC-CDR3 10
QVWDSSSDHVV
SEP ID NP: 170, LC-CDR3 11
QSYDTSLTVI
SEP ID NP: 171, LC-CDR3 13
LLYYGGAQLWV
SEP ID NP: 172, LC-CDR3 17
QQSYSAPLT
SEP ID NO: 173, LC-CDR3 22
AAWDDSLNGYV
SEP ID NO: 174, LC-CDR3 26
QSYDTSLKGV
SEP ID NP: 175, LC-CDR3 27
DSRDSSGNHWV
SEP ID NP: 176, LC-CDR3 31
NSRDSSGFPPYV
SEP ID NP: 177, LC-CDR3 32
QSWASSSVYV
SEP ID NP: 178, LC-CDR3 39
NSRDSSGNHRV
SEP ID NP: 179, LC-CDR3 40
AAWDDS LNVPV
SEP ID NP: 180, LC-CDR3 41
NSRDSGGDPVV
SEP ID NP: 181, LC-CDR3 US-5
LLYYGGARV
SEP ID NP: 182, LC-CDR3 US-7
A A WDDNLKS Y V
SEP ID NP: 183, HC-CDR1 consensus
G-F/G/Y-S/T-F-S/T-S-Y-A/G
SEP ID NP: 184, HC-CDR2 consensus 1
I-N/I-P-X-X-G-G/T/I-T/A/P
SEP ID NP: 185, HC-CDR2 consensus 2
I-S-X-S/D-G/N-G/S-N-T/I/K
SEP ID NP: 186, HC-CDR3 consensus 1
A-R-S/R-Y/S/G-Y/V-Y/W-G-X-Y-D
SEP ID NP: 187, HC-CDR3 consensus 2
A-R-G-X-X-X-Y-Y/G/S
SEP ID NP: 188, HC-CDR3 consensus 3
A-R-G-X-X-Y-Q/W-W-S-X-D-D
SEP ID NO: 189, LC-CDR1 consensus 1
N-I-G-S-N/K
SEP ID NO: 190, LC-CDR1 consensus 2
L-R-S/N-X-Y
SEP ID NP: 191, LC-CDR3 consensus
A/Q/N-S/A/V-W/Y/R-D-S/D-S-L/S/G-X-X-X-V
SEP ID NP: 192, AFP158 control peptide
FMNKFIYEI
SEP ID NP: 193, C3 control peptide (A2E-7
YLLPAIVHI
SEP ID NP: 194, A2E-1
LLDVPTAAV
SEP ID NP: 195, A2E-2
TLWVDPYEV
SEP ID NP: 196, A2E-3
FLLDHLKRV
SEP ID NP: 197, A2E-4
LLLDVPTAAV
SEP ID NP: 198, A2E-5
VLFRGGPRGLLAV
SEP ID NP: 199, A2E-6
SLLPAIVEL
SEP ID NP: 200, A2E-8
FLLPTGAEA
SEP ID NP: 201, A2E-9
LLDPKLCYLL
SEP ID NP: 202, A2E-11
MLLSVPLLLG
SEP ID NP: 203, A2E-17
MVDGTLLLL
SEP ID NP: 204, DMTN control
SLPHFHHPET
SEP ID NP: 205, PIM1 control
LLYDMVCGDIP
SEP ID NO: 206, IFI30 control
LLLDVPTAAVQ
SEP ID NO: 207, IFI30 control
LLLDVPTAAVQA
SEP ID NP: 208, SSR1 control
VLFRGGPRGLLAVA
SEP ID NP: 209, RPS6KB1 control
YMAPEILMRS
SEP ID NP: 210, CSF2RA control
FIYNADLMNC
SEP ID NP: 211, IL7 control
KQYESVLMVSI
SEP ID NP: 212, Beta globin control
KVNVDEVGGE
SEP ID NP: 213, Clone 7-1 CDS
TCCTATGAGCTGACTCAGCCACCCTCAGTGTCTGGGACCCCCGGGCAGAGGGTCG
CCATCTCCTGTTCTGGAAGCAGCTCCAACATCGGGACTCGTATGGTGACCTGGTA
CCAGCATGTCCCAGGGACGGCCCCCAAACTCCTCATCTTTAATAACAATCAGCGG
CCCTCAGGGGTCCCTGACCGATTCTCTGCCTCCAAGTCTGGCACCTCAGCCTCCC
TGGCCATCATTGGGCTCCAGTCTGACGATGAGGCTGATTATTACTGTGCAGCATG
GGATGACAACCTGAAAAGTTATGTCTTCGGAACTGGGACCAAGGTCACCGTCCT
AGGTTCTAGAGGTGGTGGTGGTAGCGGCGGCGGCGGCTCTGGTGGTGGTGGATC
CCTCGAGATGGCCCAGGTGCAGCTACAGCAGTGGGGCGCAGGACTGTTGAAGCC
TTCGGAGACCCTGTCCCTCACCTGCGCTGTCTATGGTGGGTCCTTCAGTGGTTACT
ACTGGAGCTGGATCCGCCAGCCCCCAGGGAAGGGGCTGGAGTGGATTGGGGAAA
TCAATCATAGTGGAAGCACCAACTACAACCCGTCCCTCAAGAGTCGAGTCACCA
TATCAGTAGACACGTCCAAGAACCAGTTCTCCCTGAAGCTGAGCTCTGTGACCGC
CGCGGACACGGCCGTGTATTACTGTGCGCGCGCTCCGCAGTCGTGGTACCGAGGT
GATGTTTGGGGTCAAGGTACTCTGGTGACCGTCTCCTCA
SEP ID NP: 214, Clone 7-2 CDS
TCCTATGAGCTGACTCAGCCACCCTCAGTGTCTGGGACCCCCGGGCAGAGGGTCG CCATCTCCTGTTCTGGAAGCAGCTCCAACATCGGGACTCGTATGGTGACCTGGTA CCAGCATGTCCCAGGGACGGCCCCCAAACTCCTCATCTTTAATAACAATCAGCGG CCCTCAGGGGTCCCTGACCGATTCTCTGCCTCCAAGTCTGGCACCTCAGCCTCCC TGGCCATCATTGGGCTCCAGTCTGACGATGAGGCTGATTATTACTGTGCAGCATG GGATGACAACCTGAAAAGTTATGTCTTCGGAACTGGGACCAAGGTCACCGTCCT AGGTTCTAGAGGTGGTGGTGGTAGCGGCGGCGGCGGCTCTGGTGGTGGTGGATC CCTCGAGATGGCCCAGGTGCAGCTACAGCAGTGGGGCGCAGGACTGTTGAAGCC TTCGGAGACCCTGTCCCTCACCTGCGCTGTCTATGGTGGGTCCTTCAGTGGTTACT
ACTGGAGCTGGATCCGCCAGCCCCCAGGGAAGGGGCTGGAGTGGATTGGGGAAA
TCAATCATAGTGGAAGCACCAACTACAACCCGTCCCTCAAGAGTCGAGTCACCA
TATCAGTAGACACGTCCAAGAACCAGTTCTCCCTGAAGCTGAGCTCTGTGACCGC
CGCGGACACGGCCGTGTATTACTGTTTGCGCGCGCCGCAGTCCTGGTACGTTGGT
GATGTATGGGGTCAAGGTACTCTGGTGACCGTCTCCTCA
SEP ID NO: 215, Clone 7-3 CDS
TCCTATGAGCTGACTCAGCCACCCTCAGTGTCTGGGACCCCCGGGCAGAGGGTCG
CCATCTCCTGTTCTGGAAGCAGCTCCAACATCGGGACTCGTATGGTGACCTGGTA
CCAGCATGTCCCAGGGACGGCCCCCAAACTCCTCATCTTTAATAACAATCAGCGG
CCCTCAGGGGTCCCTGACCGATTCTCTGCCTCCAAGTCTGGCACCTCAGCCTCCC
TGGCCATCATTGGGCTCCAGTCTGACGATGAGGCTGATTATTACTGTGCAGCATG
GGATGACAACCTGAAAAGTTATGTCTTCGGAACTGGGACCAAGGTCACCGTCCT
AGGTTCTAGAGGTGGTGGTGGTAGCGGCGGCGGCGGCTCTGGTGGTGGTGGATC
CCTCGAGATGGCCCAGGTGCAGCTACAGCAGTGGGGCGCAGGACTGTTGAAGCC
TTCGGAGACCATGTCCCTCACCTGCGCTGTCTATGGTGGGTCCTTCAGTGGTTACT
ACTGGAGCTGGATCCGCCAGCCCCCAGGGAAGGGGCTGGAGTGGATTGGGGAAA
TCAATCATAGTGGAAGCACCAACTACAACCCGTCCCTCAAGAGTCGAGTCACCA
TATCAGTAGACACGTCCAAGAACCAGTTCTCCCTGAAGCTGAGCTCTGTGACCGC
CGCGGACACGGCCGTGTATTACTGTGCGCGCGCCCCGCAGTCTTGGTACCGTGGT
GATGTTTGGGGTCAAGGTACTCTGGTGACCGTCTCCTCA
SEP ID NO: 216, Clone 7-5 CDS
TCCTATGAGCTGACTCAGCCACCCTCAGTGTCTGGGACCCCCGGGCAGAGGGTCG
CCATCTCCTGTTCTGGAAGCAGCTCCAACATCGGGACTCGTATGGTGACCTGGTA
CCAGCATGTCCCAGGGACGGCCCCCAAACTCCTCATCTTTAATAACAATCAGCGG
CCCTCAGGGGTCCCTGACCGATTCTCTGCCTCCAAGTCTGGCACCTCAGCCTCCC
TGGCCATCATTGGGCTCCAGTCTGACGATGAGGCTGATTATTACTGTGCAACATG
GGATGAAAACCCGAAAAGTTATGTCTTCGGAACTGGGACCAAGGTCACCGTCCT
AGGTTCTAGAGGTGGTGGTGGTAGCGGCGGCGGCGGCTCTGGTGGTGGTGGATC
CCTCGAGATGGCCCAGGTGCAGCTACAGCAGTGGGGCGCAGGACTGTTGAAGCC
TTCGGAGACCCTGTCCCTCACCTGCGCTGTCTATGGTGGGTCCTTCAGTGGTTACT
ACTGGAGCTGGATCCGCCAGCCCCCAGGGAAGGGGCTGGAGTGGATTGGGGAAA
TCAATCATAGTGGAAGCACCAACTACAACCCGTCCCTCAAGAGTCGAGTCACCA
TATCAGTAGACACGTCCAAGAACCAGTTCTCCCTGAAGCTGAGTTCTGTGACCGC
CGCGGACACGGCCGTGTATTACTGTGCGCGCGCTCCGCAGTCTTGGTACGTTGGT
GATGTTTGGGGTCAAGGTACTCTGGTGACCGTCTCCTCA
SEP ID NP: 217, Clone 7-6 CDS
TCCTATGAGCTGACTCAGCCACCCTCAGTGTCTGGGACCCCCGGGCAGAGGGTCG CCATCTCCTGTTCTGGAAGCAGCTCCAACATCGGGACTCGTATGGTGACCTGGTA CCAGCATGTCCCAGGGACGGCCCCCAAACTCCTCATCTTTAATAACAATCAGCGG CCCTCAGGGGTCCCTGACCGATTCTCTGCCTCCAAGTCTGGCACCTCAGCCTCCC TGGCCATCATTGGGCTCCAGTCTGACGATGAGGCTGATTATTACTGTGCAACATG GGAGGACAACCGGAAAAGTTATGTCTTCGGAACTGGGACCAAGGTCACCGTCCT AGGTTCTAGAGGTGGTGGTGGTAGCGGCGGCGGCGGCTCTGGTGGTGGTGGATC CCTCGAGATGGCCCAGGTGCAGCTACAGCAGTGGGGCGCAGGACTGTTGAAGCC TTCGGAGACCCTGTCCCTCACCTGCGCTGTCTATGGTGGGTCCTTCAGTGGTTACT ACTGGAGCTGGATCCGCCAGCCCCCAGGGAAGGGGCTGGAGTGGATTGGGGAAA
TCAATCATAGTGGAAGCACCAACTACAACCCGTCCCTCAAGAGTCGAGTCACCA TATCAGTAGACACGTCCAAGAACCAGTTCTCCCTGAAGCTGAGTTCTGTGACCGC CGCGGACACGGCCGTGTATTACTGTGCGCGCGCTCCGCAGTCTTGGTACGTTGGT GATGTTTGGGGTCAAGGTACTCTGGTGACCGTCTCCTCA
SEP ID NO: 218, Clone 7-7 CDS
TCCTATGAGCTGACTCAGCCACCCTCAGTGTCTGGGACCCCCGGGCAGAGGGTCG
CCATCTCCTGTTCTGGAAGCAGCTCCAACATCGGGACTCGTGTGGTGACCTGGTA
CCAGCATGTCCCAGGGACGGCCCCCAAACTCCTCATCTTTAATAACAATCAGCGG
CCCTCAGGGGTCCCTGACCGATTCTCTGCCTCCAAGTCTGGCACCTCAGCCTCCC
TGGCCATCATTGGGCTCCAGTCTGACGATGAGGCTGATTATTACTGTGCAGCATG
GGATGACAACCTGAAAAGTTACGTCTTCGGAACTGGGACCAAGGTCACCGTCCT
AGGTTCTAGAGGTGGTGGTGGTAGCGGCGGCGGCGGCTCTGGTGGTGGTGGATC
CCTCGAGATGGCCCAGGTGCAGCTACAGCAGTGGGGCGCAGGACTGTTGAAGCC
TTCGGAGACCCTGTCCCTCACCTGCGCTGTCTATGGTGGGTCCTTCAGTGGTTACT
ACTGGAGCTGGATCCGCCAGCCCCCAGGGAAGGGGCTGGAGTGGATTGGGGAAA
TCAATCATAGTGGAAGCACCAACTACAACCCGTCCCTCAAGAGTCGAGTCACCA
TATCAGTAGACACGTCCAAGAACCAGTTCTCCCTGAAGCTGAGTTCTGTGACCGC
CGCGGACACGGCCGTGTATTACTGTGCGCGCGCTCCGCAGTCTTGGTACGTTGGT
GATGTTTGGGGTCAAGGTACTCTGGTGACCGTCTCCTCA
SEP ID NO: 219, Clone 7-8 CDS
TCCTATGAGCTGACTCAGCCACCCTCAGTGTCTGGGACCCCCGGGCAGAGGGTCG
CCATCTCCTGTTCTGGAAGCAGCTCCAACATCGGGACTCGTATGGTGACCTGGTA
CCAGCATGTCCCAGGGACGGCCCCCAAACTCCTCATCTTTAATAACAATCAGCGG
CCCTCAGGGGTCCCTGACCGATTCTCTGCCTCCAAGTCTGGCACCTCAGCCTCCC
TGGCCATCATTGGGCTCCAGTCTGACGATGAGGCTGATTATTACTGTGCAACATG
GGATGACAACGTCAAAAGTTATGTCTTCGGAACTGGGACCAAGGTCACCGTCCT
AGGTTCTAGAGGTGGTGGTGGTAGCGGCGGCGGCGGCTCTGGTGGTGGTGGATC
CCTCGAGATGGCCCAGGTGCAGCTACAGCAGTGGGGCGCAGGACTGTTGAAGCC
TTCGGAGACCCTGTCCCTCACCTGCGCTGTCTATGGTGGGTCCTTCAGTGGTTACT
ACTGGAGCTGGATCCGCCAGCCCCCAGGGAAGGGGCTGGAGTGGATTGGGGAAA
TCAATCATAGTGGAAGCACCAACTACAACCCGTCCCTCAAGAGTCGAGTCACCA
TATCAGTAGACACGTCCAAGAACCAGTTCTCCCTGAAGCTGAGTTCTGTGACCGC
CGCGGACACGGCCGTGTATTACTGTGCGCGCGCTCCGCAGTCTTGGTACGTTGGT
GATGTTTGGGGTCAAGGTACTCTGGTGACCGTCTCCTCA
SEP ID NP: 220, Clone 7-9 CDS
TCCTATGAGCTGACTCAGCCACCCTCAGTGTCTGGGACCCCCGGGCAGAGGGTCG CCATCTCCTGTTCTGGAAGCAGCTCCAACATCGGGACTCGTATGGTGACCTGGTA CCAGCATGTCCCAGGGACGGCCCCCAAACTCCTCATCTTTAATAACAATCAGCGG CCCTCAGGGGTCCCTGACCGATTCTCTGCCTCCAAGTCTGGCACCTCAGCCTCCC TGGCCATCATTGGGCTCCAGTCTGACGATGAGGCTGATTATTACTGTGCAGCATG GGATGATAACCCGAAAAGTTATCACTTCGGAACTGGGACCAAGGTCACCGTCCT AGGTTCTAGAGGTGGTGGTGGTAGCGGCGGCGGCGGCTCTGGTGGTGGTGGATC CCTCGAGATGGCCCAGGTGCAGCTACAGCAGTGGGGCGCAGGACTGTTGAAGCC TTCGGAGACCCTGTCCCTCACCTGCGCTGTCTATGGTGGGTCCTTCAGTGGTTACT ACTGGAGCTGGATCCGCCAGCCCCCAGGGAAGGGGCTGGAGTGGATTGGGGAAA TCAATCATAGTGGAAGCACCAACTACAACCCGTCCCTCAAGAGTCGAGTCACCA
TATCAGTAGACACGTCCAAGAACCAGTTCTCCCTGAAGCTGAGTTCTGTGACCGC CGCGGACACGGCCGTGTATTACTGTGCGCGCGCTCCGCAGTCTTGGTACGTTGGT GATGTTTGGGGTCAAGGTACTCTGGTGACCGTCTCCTCA
SEP ID NO: 221, Clone 7-10 CDS
TCCTATGAGCTGACTCAGCCACCCTCAGTGTCTGGGACCCCCGGGCAGAGGGTCG
CCATCTCATGTTCTGGAAGCAGCTCCAACATCGGGACTCGTATGGTGACCTGGTA
CCAGCATGTCCCAGGGACGGCCCCCAAACTCCTCATCTTTAATAACAATCAGCGG
CCCTCAGGGGTCCCTGACCGATTCTCTGCCTCCAAGTCTGGCACCTCAGCCTCCC
TGACCATCATTGGGCTCCAGTCTGACGATGAGGCTGATTATTACTGTGCAGCATG
GGATGACAACCTGAAAAGTTATGTCTTCGGAACTGGGACCAAGGTCACCGTCCT
AGGTTCTAGAGGTGGTGGTGGTAGCGGCGGCGGCGGCTCTGGTGGTGGTGGATC
CCTCGAGATGGCCCAGGTGCAGCTACAGCAGTGGGGCGCAGGACTGTTGAAGCC
TTCGGAGACCCTGTCCCTCACCTGCGCTGTCTATGGTGGGTCCTTCAGTGGTTACT
ACTGGAGCTGGATCCGCCAGCCCCCAGGGAAGGGGCTGGAGTGGATTGGGGAAA
TCAATCATAGTGGAAGCACCAACTACAACCCGTCCCTCAAGAGTCGAGTCACCA
TGTCAGTAGACACGTCCAAGAGGCAGTTCTCCCTGAAGCTGAGTTCTGTGACCGC
CGCGGACACGGCCGTGTATTACTGTGCGCGCGCTCCGCAGTCTTGGTACGTTGGT
GATGTTTGGGGTCAAGGTACTCTGGTGACCGTCTCCTCA
SEP ID NO: 222, Clone 7-11 CDS
TCCTATGAGCTGACTCAGCCACCCTCAGTGTCTGGGACCCCCGGGCAGAGGGTCG
CCATCTCCTGTTCTGGAAGCAGCTCCAACATCGGGACTCGTATGGTGACCTGGTA
CCAGCATGTCCCAGGGACGGCCCCCAAACTCCTCATCTTTAATAACAATCAGCGG
CCCTCAGGGGTCCCTGACCGATTCTCTGCCTCCAAGTCTGGCACCTCAGCCTCCC
TGGCCATCATTGGGCTCCAGTCTGACGATGAGGCTGATTATTACTGTGCAGCATG
GGATGACAACCTGAAAAGTTATGTCTTCGGAACTGGGACCAAGGTCACCGTCCT
AGGTTCTAGAGGTGGTGGTGGTAGCGGCGGCGGCGGCTCTGATGGTGGTGGATC
CCTCGAGATGGCCCAGGTGCAGCTACAGCAGTGGGGCGCAGGACTGTTGAAGCC
TTCGGAGACCCTGTCCCTCACCTGCGCTGTCTATGGTGGGTCCTTCAGTGGTTACT
ACTGGAGCTGGATCCGCCAGCTCCCAGGGAAGGGGCTGGAGTGGATTGGGGAAA
TCAATCATAGTGGAAGCACCAACTACAACCCGTACCTCAAGAGTCGAGTCACCA
TATCAGTAGACACGTCCAAGAGGCAGTTCTCCCTGAAGCTGAGTTCTGTGACCGC
CGCGGACACGGCCGTGTATTACTGTGCGCGCGCTCCGCAGTCTTGGTACGTTGGT
GATGTTTGGGGTCAAGGTACTCTGGTGACCGTCTCCTCA
SEP ID NP: 223, Clone 7-1 protein
S YELTQPPS VS GTPGQR V AIS CS GS S S NIGTRM VT W YQH VPGT APKLLIFNNNQRPS G VPDRFSASKSGTSASLAIIGLQSDDEADYYCAAWDDNLKSYVFGTGTKVTVLGSRG GGGS GGGGS GGGGS LEM AQVQLQQWGAGLLKPSETLS LTC A VYGGSFS GYYWS WI RQPPGKGLE WIGEINHS GS TN YNPS LKS R VTIS VDTS KNQFS LKLS S VT A ADT A V Y YC ARAPQS W YRGD VWGQGTLVT VS S
SEP ID NP: 224, Clone 7-2 protein
S YELTQPPS VS GTPGQR V AIS CS GS S S NIGTRM VTW YQH VPGT APKLLIFNNNQRPS G VPDRFSASKSGTSASLAIIGLQSDDEADYYCAAWDDNLKSYVFGTGTKVTVLGSRG GGGS GGGGS GGGGS LEM AQVQLQQWGAGLLKPSETLS LTC A VYGGSFS GYYWS WI RQPPGKGLE WIGEINHS GS TN YNPS LKS R VTIS VDTS KNQFS LKLS S VT A ADT A V Y YC LRAPQS W YVGD VWGQGTLVTVS S
SEP ID NO: 225, Clone 7-3protein
S YELTQPPS VS GTPGQR V AIS CS GS S S NIGTRM VT W YQH VPGT APKLLIFNNNQRPS G VPDRFSASKSGTSASLAIIGLQSDDEADYYCAAWDDNLKSYVFGTGTKVTVLGSRG GGGSGGGGSGGGGSLEMAQVQLQQWGAGLLKPSETMSLTCAVYGGSFSGYYWSWI RQPPGKGLE WIGEINHS GS TN YNPS LKS R VTIS VDTS KNQFS LKLS S VT A ADT A V Y YC ARAPQS W YRGD VWGQGTLVT VS S
SEP ID NO: 226, Clone 7-5 protein
S YELTQPPS VS GTPGQR V AIS CS GS S S NIGTRM VTW YQH VPGT APKLLIFNNNQRPS G VPDRFSASKSGTSASLAIIGLQSDDEADYYCATWDENPKSYVFGTGTKVTVLGSRGG GGSGGGGSGGGGSLEMAQVQLQQWGAGLLKPSETLSLTCAVYGGSFSGYYWSWIR QPPGKGLEWIGEINHS GS TN YNPS LKS RVTIS VDTS KNQFS LKLS S VT A ADT A V Y YC A RAPQSWYVGD VWGQGTLVT VS S
SEP ID NP: 227, Clone 7-6 protein
S YELTQPPS VS GTPGQR V AIS CS GS S S NIGTRM VTW YQH VPGT APKLLIFNNNQRPS G VPDRFS AS KS GTS AS LAIIGLQS DDE AD Y YC AT WEDNRKS Y VFGTGTKVT VLGS RGG GGSGGGGSGGGGSLEMAQVQLQQWGAGLLKPSETLSLTCAVYGGSFSGYYWSWIR QPPGKGLEWIGEINHS GS TN YNPS LKS RVTIS VDTS KNQFS LKLS S VT A ADT A V Y YC A RAPQSWYVGD VWGQGTLVT VS S
SEP ID NP: 228, Clone 7-7 protein
S YELTQPPS VS GTPGQR V AIS CS GS S S NIGTRV VTW YQH VPGT APKLLIFNNNQRPS G VPDRFSASKSGTSASLAIIGLQSDDEADYYCAAWDDNLKSYVFGTGTKVTVLGSRG GGGS GGGGS GGGGS LEM AQVQLQQWGAGLLKPSETLS LTC A VYGGSFS GYYWS WI RQPPGKGLE WIGEINHS GS TN YNPS LKS RVTIS VDTS KNQFS LKLS S VT A ADT A V Y YC ARAPQS WYVGD VWGQGTLVT VS S
SEP ID NP: 229, Clone 7-8 protein
S YELTQPPS VS GTPGQR V AIS CS GS S S NIGTRM VTW YQH VPGT APKLLIFNNNQRPS G VPDRFSASKSGTSASLAIIGLQSDDEADYYCATWDDNVKSYVFGTGTKVTVLGSRG GGGS GGGGS GGGGS LEM AQVQLQQWGAGLLKPSETLS LTC A VYGGSFS GYYWS WI RQPPGKGLE WIGEINHS GS TN YNPS LKS RVTIS VDTS KNQFS LKLS S VT A ADT A V Y YC ARAPQS WYVGD VWGQGTLVT VS S
SEP ID NP: 230, Clone 7-9 protein
S YELTQPPS VS GTPGQR V AIS CS GS S S NIGTRM VTW YQH VPGT APKLLIFNNNQRPS G VPDRFSASKSGTSASLAIIGLQSDDEADYYCAAWDDNPKSYHFGTGTKVTVLGSRGG GGSGGGGSGGGGSLEMAQVQLQQWGAGLLKPSETLSLTCAVYGGSFSGYYWSWIR QPPGKGLEWIGEINHS GS TN YNPS LKS RVTIS VDTS KNQFS LKLS S VT A ADT A V Y YC A RAPQSWYVGD VWGQGTLVT VS S
SEP ID NP: 231, Clone 7-10 protein
S YELTQPPS VS GTPGQR V AIS CS GS S S NIGTRM VTW YQH VPGT APKLLIFNNNQRPS G VPDRFS AS KS GTS AS LTIIGLQS DDE AD Y YC A A WDDNLKS Y VFGTGTKVT VLGS RGG GGSGGGGSGGGGSLEMAQVQLQQWGAGLLKPSETLSLTCAVYGGSFSGYYWSWIR QPPGKGLEWIGEINHS GS TN YNPS LKS RVTMS VDTS KRQFS LKLS S VT A ADT A V Y YC ARAPQS WYVGD VWGQGTLVT VS S
SEP ID NO: 232, Clone 7-11 protein
S YELTQPPS VS GTPGQR V AIS CS GS S S NIGTRM VT W YQH VPGT APKLLIFNNNQRPS G VPDRFSASKSGTSASLAIIGLQSDDEADYYCAAWDDNLKSYVFGTGTKVTVLGSRG GGGSGGGGSDGGGSLEMAQVQLQQWGAGLLKPSETLSLTCAVYGGSFSGYYWSWI RQLPGKGLEWIGEINHS GS TN YNP YLKS R VTIS VDTS KRQFS LKLS S VT A ADT A V Y YC ARAPQS W YVGD VWGQGTLVT VS S
SEP ID NO: 233, HCVR 7-1
QVQLQQWGAGLLKPSETLSLTCAVYGGSFSGYYWSWIRQPPGKGLEWIGEINHSGST NYNPSLKSRVTISVDTSKNQFSLKLSSVTAADTAVYYCARAPQSWYRGDVWGQGTL VTVSS
SEP ID NP: 234, HCVR 7-2
QVQLQQWGAGLLKPSETLSLTCAVYGGSFSGYYWSWIRQPPGKGLEWIGEINHSGST NYNPSLKSRVTISVDTSKNQFSLKLSSVTAADTAVYYCLRAPQSWYVGDVWGQGTL VTVSS
SEP ID NP: 235, HCVR 7-3
QVQLQQWGAGLLKPSETMSLTCAVYGGSFSGYYWSWIRQPPGKGLEWIGEINHSGS TN YNPS LKS R VTIS VDTS KNQFS LKLS S VT A ADT A V Y YC AR APQS W YRGD V WGQGT LVTVSS
SEP ID NP: 236, HCVR 7-10
QVQLQQWGAGLLKPSETLSLTCAVYGGSFSGYYWSWIRQPPGKGLEWIGEINHSGST NYNPSLKSRVTMSVDTSKRQFSLKLSSVTAADTAVYYCARAPQSWYVGDVWGQGT LVTVSS
SEP ID NP: 237, HCVR 7-11
QVQLQQWGAGLLKPSETLSLTCAVYGGSFSGYYWSWIRQLPGKGLEWIGEINHSGS TN YNP YLKS RVTIS VDTS KRQFS LKLS S VT A ADT A V Y YC ARAPQS W Y VGD V WGQG TLVTVSS
SEP ID NP: 238, LCVR 7-5
S YELTQPPS VS GTPGQR V AIS CS GS S S NIGTRM VTW YQH VPGT APKLLIFNNNQRPS G VPDRFSASKSGTSASLAIIGLQSDDEADYYCATWDENPKSYVFGTGTKVTVLG
SEP ID NP: 239, LCVR 7-6
S YELTQPPS VS GTPGQR V AIS CS GS S S NIGTRM VTW YQH VPGT APKLLIFNNNQRPS G VPDRFSASKSGTSASLAIIGLQSDDEADYYCATWEDNRKSYVFGTGTKVTVLG
SEP ID NP: 240, LCVR 7-7
S YELTQPPS VS GTPGQR V AIS CS GS S S NIGTRV VTW YQH VPGT APKLLIFNNNQRPS G VPDRFSASKSGTSASLAIIGLQSDDEADYYCAAWDDNLKSYVFGTGTKVTVLG
SEP ID NP: 241, LCVR 7-8
S YELTQPPS VS GTPGQR V AIS CS GS S S NIGTRM VTW YQH VPGT APKLLIFNNNQRPS G VPDRFSASKSGTSASLAIIGLQSDDEADYYCATWDDNVKSYVFGTGTKVTVLG
SEP ID NO: 242, LCVR 7-9
S YELTQPPS VS GTPGQR V AIS CS GS S S NIGTRM VT W YQH VPGT APKLLIFNNNQRPS G VPDRFSASKSGTSASLAIIGLQSDDEADYYCAAWDDNPKSYHFGTGTKVTVLG
SEP ID NO: 243, LCVR 7-10
S YELTQPPS VS GTPGQR V AIS CS GS S S NIGTRM VTW YQH VPGT APKLLIFNNNQRPS G VPDRFS AS KS GTS AS LTIIGLQS DDE AD Y YC A A WDDNLKS Y VFGTGTKVT VLG
SEP ID NP: 244, HC-CDR3 7-1
ARAPQSWYRGDV
SEP ID NP: 245, HC-CDR3 7-2
LRAPQSWYVGDV
SEP ID NP: 246, LC-CDR1 7-7
SSNIGTRV
SEP ID NP: 247, LC-CDR3 7-5
ATWDENPKS Y V
SEP ID NP: 248, LC-CDR3 7-6
ATWEDNRKS Y V
SEP ID NP: 249, LC-CDR3 7-8
ATWDDN VKS Y V
SEP ID NP: 250, LC-CDR3 7-9
A A WDDNPKS YH
SEP ID NP: 251, HC-FR1 7-3
VQLQQWGAGLLKPSETMSLTCAVY
SEP ID NP: 252, HC-FR2 7-11
WSWIRQLPGKGLEWIGE
SEP ID NP: 253, HC-FR3 7-10
N YNPS LKS RVTMS VDTS KRQFS LKLS S VT A ADT A V Y YC SEP ID NP: 254, HC-FR3 7-11
N YNP YLKS R VTIS VDTS KRQFS LKLS S VT A ADT A V Y YC SEP ID NP: 255, LC-FR3 7-10
QRPS G VPDRFS AS KS GTS AS LTIIGLQS DDE AD Y YC SEP ID NP: 256, CD28/CD3C
AAAIEVMYPPPYLDNEKSNGTIIHVKGKHLCPSPLFPGPSKPFWVLVVVGGVLACYS LLVT V AFIIFW VRS KRS RLLHS D YMNMTPRRPGPTRKH YQP Y APPRDF A A YRS RVKF SRSADAPAYQQGQNQLYNELNLGRREEYDVLDKRRGRDPEMGGKPRRKNPQEGLY NELQKDKMAEAYSEIGMKGERRRGKGHDGLYQGLSTATKDTYDALHMQALPPR
SEP ID NO: 257, 4-1BB/CD3C
TGTTTPAPRPPTPAPTIAS QPLS LRPEACRPAAGGA VHTRGLDFACDIYIW APLAGTC
GVLLLSLVITLYCKRGRKKLLYIFKQPFMRPVQTTQEEDGCSCRFPEEEEGGCELRVK
FSRSADAPAYQQGQNQLYNELNLGRREEYDVLDKRRGRDPEMGGKPRRKNPQEGL
YNELQKDKMAEAYSEIGMKGERRRGKGHDGLYQGLSTATKDTYDALHMQALPPR
SEP ID NO: 258, HPV16 E7 11-19 A2
YALDLQPET
SEP ID NP: 259, HPV16 E7 11-19 A3
YMADLQPET
SEP ID NP: 260, HPV16 E7 11-19 A4
YMLALQPET
SEP ID NP: 261, HPV16 E7 11-19 A6
YMLDLAPET
SEP ID NP: 262, HPV16 E7 11-19 A7
YMLDLQAET
SEP ID NP: 263, HPV16 E7 11-19 A9
YMLDLQPEA
Claims
1. An isolated anti-E7MC construct comprising an antibody moiety that specifically binds to a complex comprising human papilloma virus subtype 16 (HPV16) E7 peptide and a major histocompatibility (MHC) class I protein (an HPV16-E7/MHC class I complex, or E7MC).
2. The isolated anti-E7MC construct of claim 1, wherein the MHC class I protein is selected from the group consisting of HLA-A*02:01, HLA-A*02:02, HLA-A*02:06, HLA-A*02:07, and HLA-A*02: 11.
3. The isolated anti-E7MC construct of claim 2, wherein the MHC class I protein is HLA-A*02:01.
4. The isolated anti-E7MC construct of any one of claims 1-3, wherein the HPV16-E7 peptide has an amino acid sequence selected from the group consisting of SEQ ID NOs: 3-14.
5. The isolated anti-E7MC construct of claim 4, wherein the HPV16-E7 peptide has the amino acid sequence of YMLDLQPET (SEQ ID NO: 4).
6. The isolated anti-E7MC construct of any one of claims 1-5, wherein the antibody moiety is a full-length antibody, a Fab, a Fab', a (Fab')2, an Fv, or a single chain Fv (scFv).
7. The isolated anti-E7MC construct of any one of claims 1-6, wherein the isolated anti- E7MC construct binds to the HPV16-E7/MHC class I complex with a Kd from about 0.1 pM to about 500 nM.
8. The isolated anti-E7MC construct of any one of claims 1-7, wherein the antibody moiety comprises:
i) a heavy chain variable domain comprising a heavy chain complementarity determining region (HC-CDR) 1 comprising the amino acid sequence of G-F/G/Y- S/T-F-S/T-S-Y-A/G (SEQ ID NO: 183), or a variant thereof comprising up to about 3 amino acid substitutions, an HC-CDR2 comprising the amino acid sequence of I-N/I- P-X-X-G-G/T/I-T/A/P or I-S-X-S/D-G/N-G/S-N-T/I/K (SEQ ID NO: 184 or 185), or a variant thereof comprising up to about 3 amino acid substitutions, and an HC-CDR3 comprising the amino acid sequence of any one of A-R-S/R-Y/S/G- Y/V-Y/W -G-X-
Y-D, A-R-G-X-X-X-Y-Y/G/S, or A-R-G-X-X-Y-Q/W-W-S-X-D-D (SEQ ID NOs: 186-188), or a variant thereof comprising up to about 3 amino acid substitutions; and ii) a light chain variable domain comprising a light chain complementarity
determining region (LC-CDR) 1 comprising the amino acid sequence of N-I-G-S-N/K or L-R-S/N-X-Y (SEQ ID NO: 189 or 190), or a variant thereof comprising up to about 3 amino acid substitutions, and an LC-CDR3 comprising the amino acid sequence of A/Q/N-S/A/V-W/Y/R-D-S/D-S-L/S/G-X-X-X-V (SEQ ID NO: 191), or a variant thereof comprising up to about 3 amino acid substitutions, wherein X can be any amino acid.
9. The isolated anti-E7MC construct of any one of claims 1-7, wherein the antibody moiety comprises:
i) a heavy chain variable domain comprising an HC-CDRl comprising the amino acid sequence of any one of SEQ ID NOs: 57-77, or a variant thereof comprising up to about 5 amino acid substitutions, an HC-CDR2 comprising the amino acid sequence of any one of SEQ ID NOs: 78-98, or a variant thereof comprising up to about 5 amino acid substitutions, and an HC-CDR3 comprising the amino acid sequence of any one of SEQ ID NOs: 99-119, 244, and 245; or a variant thereof comprising up to about 5 amino acid substitutions; and
ii) a light chain variable domain comprising an LC-CDR 1 comprising the amino acid sequence of any one of SEQ ID NOs: 120-140 and 246, or a variant thereof comprising up to about 5 amino acid substitutions, an LC-CDR2 comprising the amino acid sequence of any one of SEQ ID NOs: 141-161, or a variant thereof comprising up to about 3 amino acid substitutions, and an LC-CDR3 comprising the amino acid sequence of any one of SEQ ID NOs: 162-182 and 247-250; or a variant thereof comprising up to about 5 amino acid substitutions.
10. The isolated anti-E7MC construct of claim 9, wherein the antibody moiety comprises a) a heavy chain variable domain comprising the amino acid sequence of any one of SEQ ID NOs: 15-35 and 233-237, or a variant thereof having at least about 95% sequence identify to any one of SEQ ID NOs: 15-35 and 233-237; and b) a light chain variable domain comprising the amino acid sequence of any one of SEQ ID NOs: 36- 56 and 238-243, or a variant thereof having at least about 95% sequence identity to any one of SEQ ID NOs: 36-56 and 238-243.
11. The isolated anti-E7MC construct of any one of claims 1- 10, wherein the isolated anti-E7MC construct is multispecific.
12. The isolated anti-E7MC construct of claim 11, wherein the isolated anti-E7MC
construct is a tandem scFv, a diabody (Db), a single chain diabody (scDb), a dual- affinity retargeting (DART) antibody, a dual variable domain (DVD) antibody, a knob-into-hole (KiH) antibody, a dock and lock (DNL) antibody, a chemically cross- linked antibody, a heteromultimeric antibody, or a heteroconjugate antibody.
13. The isolated anti-E7MC construct of claim 12, wherein the isolated anti-E7MC
construct is a tandem scFv comprising two scFvs linked by a peptide linker.
14. The isolated anti-E7MC construct of any one of claims 11- 13, wherein the isolated anti-E7MC construct further comprises a second antibody moiety that specifically binds to a second antigen.
15. The isolated anti-E7MC construct of claim 14, wherein the second antigen is selected from the group consisting of CD3y, CD35, CD3s, ΟΌ3ζ, CD28, OX40, GITR, CD137, CD27, CD40L and HVEM.
16. The isolated anti-E7MC construct of claim 14, wherein the second antigen is CD3s, and wherein the isolated anti-E7MC construct is a tandem scFv comprising an N- terminal scFv specific for the HPV16-E7/MHC class I complex and a C-terminal scFv specific for CD3s.
17. The isolated anti-E7MC construct of any one of claims 1- 10, wherein the isolated anti-E7MC construct is a chimeric antigen receptor comprising an extracellular domain comprising the antibody moiety, a transmembrane domain, and an
intracellular signaling domain comprising a CD3ζ intracellular signaling sequence and a CD28 intracellular signaling sequence.
18. The isolated anti-E7MC construct of any one of claims 1- 10, wherein the isolated anti-E7MC construct is an immunoconjugate comprising the antibody moiety and an effector molecule, wherein the effector molecule is a therapeutic agent selected from the group consisting of a drug, a toxin, a radioisotope, a protein, a peptide, and a nucleic acid.
19. The isolated anti-E7MC construct of any one of claims 1- 10, wherein the isolated anti-E7MC construct is an immunoconjugate comprising the antibody moiety and a label.
20. A pharmaceutical composition comprising the isolated anti-E7MC construct of any one of claims 1-18.
21. A host cell expressing the isolated anti-E7MC construct of any one of claims 1-19.
22. A nucleic acid encoding the polypeptide components of the isolated anti-E7MC
construct of any one of claims 1-19.
23. An effector cell expressing the isolated anti-E7MC construct of claim 17.
24. The effector cell of claim 23, wherein the effector cell is a T cell.
25. A method of detecting a cell presenting a complex comprising an HPV16-E7 peptide and an MHC class I protein on its surface, comprising contacting the cell with the isolated anti-E7MC construct of claim 19 and detecting the presence of the label on the cell.
26. A method of treating an individual having an HPV16-E7-positive disease, comprising administering to the individual:
a) an effective amount of the pharmaceutical composition of claim 20; or b) an effective amount of the effector cell of claim 23 or 24.
27. A method of diagnosing an individual having an HPV16-E7-positive disease,
comprising:
a) administering an effective amount of the isolated anti-E7MC construct of claim 19 to the individual; and
b) determining the level of the label in the individual, wherein a level of the label above a threshold level indicates that the individual has the HPV16-E7-positive disease.
28. A method of diagnosing an individual having an HPV16-E7-positive disease,
comprising:
a) contacting a sample derived from the individual with the isolated anti-E7MC construct of claim 19; and
b) determining the number of cells bound with the isolated anti-E7MC construct in the sample, wherein a value for the number of cells bound with the isolated anti- E7MC construct above a threshold level indicates that the individual has the HPV16- E7-positive disease.
29. The method of any one of claims 26-28, wherein the HPV16-E7-positive disease is HPV16-E7-positive cancer.
30. The method of claim 29, wherein the HPV16-E7-positive cancer is squamous cell carcinoma.
31. The method of claim 29, wherein the HPV16-E7-positive cancer is cervical cancer, anogenital cancer, head and neck cancer, or oropharyngeal cancer.
Applications Claiming Priority (3)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
US201562158735P | 2015-05-08 | 2015-05-08 | |
US201562197480P | 2015-07-27 | 2015-07-27 | |
PCT/US2016/031364 WO2016182957A1 (en) | 2015-05-08 | 2016-05-06 | Constructs targeting hpv16-e7 peptide/mhc complexes and uses thereof |
Publications (1)
Publication Number | Publication Date |
---|---|
EP3294328A1 true EP3294328A1 (en) | 2018-03-21 |
Family
ID=57249446
Family Applications (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
EP16793285.4A Withdrawn EP3294328A1 (en) | 2015-05-08 | 2016-05-06 | Constructs targeting hpv16-e7 peptide/mhc complexes and uses thereof |
Country Status (12)
Country | Link |
---|---|
EP (1) | EP3294328A1 (en) |
JP (1) | JP2018516879A (en) |
KR (1) | KR20170141256A (en) |
CN (1) | CN107847570A (en) |
AU (1) | AU2016261356A1 (en) |
CA (1) | CA2988397A1 (en) |
IL (1) | IL255228A0 (en) |
MX (1) | MX2017014056A (en) |
RU (1) | RU2017142716A (en) |
SG (1) | SG11201708674XA (en) |
TW (1) | TW201713695A (en) |
WO (1) | WO2016182957A1 (en) |
Families Citing this family (16)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
SG10201913247XA (en) | 2015-10-23 | 2020-02-27 | Eureka Therapeutics Inc | Antibody/t-cell receptor chimeric constructs and uses thereof |
CA3059753A1 (en) | 2017-04-26 | 2018-11-01 | Eureka Therapeutics, Inc. | Chimeric antibody/t-cell receptor constructs and uses thereof |
CN110914295B (en) * | 2017-06-28 | 2024-08-09 | 里珍纳龙药品有限公司 | Anti-Human Papilloma Virus (HPV) antigen binding proteins and methods of use thereof |
JP2020537515A (en) | 2017-10-03 | 2020-12-24 | ジュノー セラピューティクス インコーポレイテッド | HPV-specific binding molecule |
SG11202003585VA (en) * | 2017-10-20 | 2020-05-28 | Pharmabcine Inc | Anti-vista antibody and use thereof |
KR20210019993A (en) * | 2018-04-05 | 2021-02-23 | 주노 쎄러퓨티크스 인코퍼레이티드 | Τ Cell receptor and engineered cells expressing it |
CN110776562B (en) * | 2018-07-30 | 2022-06-17 | 香雪生命科学技术(广东)有限公司 | T cell receptor for identifying AFP antigen |
CN113045655A (en) * | 2019-12-27 | 2021-06-29 | 高诚生物医药(香港)有限公司 | anti-OX 40 antibodies and uses thereof |
CN115667302A (en) | 2020-02-06 | 2023-01-31 | 亚洲大学校产学协力团 | Fusion antibody for presenting antigen-derived T cell epitope or peptide containing the epitope on cell surface, and composition containing the fusion antibody |
PL3872091T3 (en) | 2020-02-26 | 2023-12-27 | Vir Biotechnology, Inc. | Antibodies against sars-cov-2 |
CN113321726B (en) * | 2020-02-28 | 2024-05-28 | 香雪生命科学技术(广东)有限公司 | T cell receptor for recognizing HPV |
CN113801217A (en) * | 2020-06-17 | 2021-12-17 | 香雪生命科学技术(广东)有限公司 | High-affinity T cell receptor for recognizing HPV (human papilloma Virus) antigen |
AR124414A1 (en) | 2020-12-18 | 2023-03-22 | Century Therapeutics Inc | CHIMERIC ANTIGEN RECEPTOR SYSTEM WITH ADAPTABLE RECEPTOR SPECIFICITY |
CN113637690A (en) * | 2021-08-18 | 2021-11-12 | 武汉华美生物工程有限公司 | Preparation method and application of human papilloma virus HPV16 type E7 active protein |
WO2023133193A1 (en) * | 2022-01-05 | 2023-07-13 | Memorial Sloan-Kettering Cancer Center | Anti-hpv antibodies and uses thereof |
WO2024050399A1 (en) * | 2022-09-01 | 2024-03-07 | The United States Of America, As Represented By The Secretary, Department Of Health And Human Services | Single domain antibodies targeting hpv e6/e7 oncogenic peptide/mhc complexes |
Family Cites Families (1)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US20090304679A1 (en) * | 2004-05-27 | 2009-12-10 | Weidanz Jon A | Antibodies as T cell receptor mimics, methods of production and uses thereof |
-
2016
- 2016-05-06 KR KR1020177035048A patent/KR20170141256A/en unknown
- 2016-05-06 CN CN201680039553.5A patent/CN107847570A/en active Pending
- 2016-05-06 WO PCT/US2016/031364 patent/WO2016182957A1/en active Application Filing
- 2016-05-06 JP JP2017557069A patent/JP2018516879A/en active Pending
- 2016-05-06 CA CA2988397A patent/CA2988397A1/en not_active Abandoned
- 2016-05-06 AU AU2016261356A patent/AU2016261356A1/en not_active Abandoned
- 2016-05-06 RU RU2017142716A patent/RU2017142716A/en not_active Application Discontinuation
- 2016-05-06 EP EP16793285.4A patent/EP3294328A1/en not_active Withdrawn
- 2016-05-06 SG SG11201708674XA patent/SG11201708674XA/en unknown
- 2016-05-06 MX MX2017014056A patent/MX2017014056A/en unknown
- 2016-05-09 TW TW105114353A patent/TW201713695A/en unknown
-
2017
- 2017-10-24 IL IL255228A patent/IL255228A0/en unknown
Also Published As
Publication number | Publication date |
---|---|
CA2988397A1 (en) | 2016-11-17 |
KR20170141256A (en) | 2017-12-22 |
IL255228A0 (en) | 2017-12-31 |
TW201713695A (en) | 2017-04-16 |
WO2016182957A1 (en) | 2016-11-17 |
JP2018516879A (en) | 2018-06-28 |
RU2017142716A (en) | 2019-06-10 |
MX2017014056A (en) | 2018-04-10 |
AU2016261356A1 (en) | 2018-01-04 |
SG11201708674XA (en) | 2017-11-29 |
CN107847570A (en) | 2018-03-27 |
Similar Documents
Publication | Publication Date | Title |
---|---|---|
US20210277117A1 (en) | Constructs targeting afp peptide/mhc complexes and uses thereof | |
US20190382504A1 (en) | Constructs targeting ny-eso-1 peptide/mhc complexes and uses thereof | |
WO2016182957A1 (en) | Constructs targeting hpv16-e7 peptide/mhc complexes and uses thereof | |
WO2018200586A9 (en) | Constructs specifically recognizing glypican 3 and uses thereof | |
US11274157B2 (en) | Constructs targeting histone H3 peptide/MHC complexes and uses thereof | |
CA3103936A1 (en) | Constructs targeting prostate-specific membrane antigen (psma) and uses thereof | |
US20200087400A1 (en) | Constructs targeting psa peptide/mhc complexes and uses thereof | |
WO2018057967A2 (en) | Constructs targeting hiv peptide/mhc complexes and uses thereof | |
KR102721595B1 (en) | Constructs targeting AFP peptide/MHC complexes and uses thereof |
Legal Events
Date | Code | Title | Description |
---|---|---|---|
PUAI | Public reference made under article 153(3) epc to a published international application that has entered the european phase |
Free format text: ORIGINAL CODE: 0009012 |
|
17P | Request for examination filed |
Effective date: 20171129 |
|
AK | Designated contracting states |
Kind code of ref document: A1 Designated state(s): AL AT BE BG CH CY CZ DE DK EE ES FI FR GB GR HR HU IE IS IT LI LT LU LV MC MK MT NL NO PL PT RO RS SE SI SK SM TR |
|
AX | Request for extension of the european patent |
Extension state: BA ME |
|
DAV | Request for validation of the european patent (deleted) | ||
DAX | Request for extension of the european patent (deleted) | ||
STAA | Information on the status of an ep patent application or granted ep patent |
Free format text: STATUS: THE APPLICATION IS DEEMED TO BE WITHDRAWN |
|
18D | Application deemed to be withdrawn |
Effective date: 20181201 |